DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Cpr62Bc

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001261293.1 Gene:Cpr62Bc FlyBaseID:FBgn0035281 Length:180 Species:Drosophila melanogaster

Alignment Length:203 Identity:50/204 (25%)
Similarity:72/204 (35%) Gaps:63/204 (31%)


  Fly     5 LLLLGSLSLA-------HGLALY--YPYAYTAEG---SAVFTPTQRQYIAKDELGQYSYGYSE-- 55
            |:.|..||.|       ||..||  .|..|...|   ..:......:|       .|:||.::  
  Fly     7 LICLAVLSAASAGVLHGHGAGLYAAAPAIYAGHGHHDEGIDYHAYPKY-------HYNYGVADSH 64

  Fly    56 --PLSSKQETRTLDG-ITQGYYSYRDAAGKLQTVNYVA-DNKGFHVAATNLPKAKVPQESLEFSP 116
              .:.|:.|.|  || :.:|.||..:..|.::||.|.| |:.||:...                 
  Fly    65 TGDVKSQHEVR--DGDVVKGSYSLVEPDGSVRTVEYTADDHNGFNAVV----------------- 110

  Fly   117 RSASHPVDHHVEHHAEVSHA--VVQHPVGHHPIEVPHH--------------HTVVESGRSAHPD 165
             ..:.|..||.. .|.|:||  .|.|....:...:.||              |.|...|.:.| :
  Fly   111 -HKTGPTVHHAA-PAVVAHAAPAVVHAAPAYAPAIAHHVAAAPAVPYAGSLAHQVPAYGYATH-N 172

  Fly   166 GHHPVEHH 173
            .|..|.|:
  Fly   173 AHAHVAHY 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 18/52 (35%)
Cpr62BcNP_001261293.1 Chitin_bind_4 54..106 CDD:278791 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.