| Sequence 1: | NP_648882.1 | Gene: | Cpr72Ea / 39814 | FlyBaseID: | FBgn0036617 | Length: | 341 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001137869.1 | Gene: | Cpr62Bb / 38240 | FlyBaseID: | FBgn0035280 | Length: | 194 | Species: | Drosophila melanogaster |
| Alignment Length: | 283 | Identity: | 63/283 - (22%) |
|---|---|---|---|
| Similarity: | 95/283 - (33%) | Gaps: | 113/283 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 LLLLGSLSLAH-GLAL-YYPYAYTAEGSAVFTPTQRQYIAKDELGQYSYGYSE----PLSSKQET 63
Fly 64 RTLDG-ITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKVPQESLEFSPRSASHPVDHH 126
Fly 127 VEHHAEVSHAVVQHP-VGHHPIEVPHHHTVVESGRSAHPDGHHPVEHHEHRVAVAQHPVGHHPVE 190
Fly 191 VPHHHTVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHHHTVVESGRSAHPEVPHSIE 255
Fly 256 HHEHPVSGSDPSGSHGGHSQLPH 278 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cpr72Ea | NP_648882.1 | Chitin_bind_4 | 49..95 | CDD:278791 | 17/51 (33%) |
| Cpr62Bb | NP_001137869.1 | Chitin_bind_4 | 35..87 | CDD:395303 | 18/74 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR12236 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||