DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Cpr62Ba

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001137868.1 Gene:Cpr62Ba FlyBaseID:FBgn0035279 Length:136 Species:Drosophila melanogaster

Alignment Length:114 Identity:30/115 (26%)
Similarity:52/115 (45%) Gaps:31/115 (27%)


  Fly    24 AYTAEGSA----VFTPTQRQYIAKDELGQYSYGYS-EPLSSK-----QETRTLDGITQGYYSYRD 78
            |:|..|.|    .::...|.:  .:|...||:.|. ..::|:     :|.|..|.:: |.||:.:
  Fly    18 AHTQRGPAGHIEFYSDYGRNH--DEERLHYSHQYHISDVASRVHILHREQRHGDYVS-GSYSHLE 79

  Fly    79 AAGKLQTVNYV--ADNKGFHVAATNLPKAKVPQ--------ESLEFSPR 117
            .:|.:::|:|.  ..|:||        ||.|.|        ::|||..|
  Fly    80 PSGHIRSVHYEVRGANRGF--------KAVVEQRTGNSRVHQTLEFRSR 120

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 15/54 (28%)
Cpr62BaNP_001137868.1 Chitin_bind_4 45..89 CDD:278791 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.