DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Lcp9

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster


Alignment Length:75 Identity:20/75 - (26%)
Similarity:31/75 - (41%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SAVFTPTQRQYIAKD-ELGQYSYGYSEPLSS---KQETRTL----DGITQGYYSYRDAAGKLQTV 86
            :.||...:...:..| |:....:.|:..||:   ..:|..|    :.:..|.|.|....||...|
  Fly    12 AVVFANEEADVVKSDSEVNLLDFNYAYELSNHIRAVQTGALKEHDNWVVSGEYEYVAPNGKTVKV 76

  Fly    87 NYVADNKGFH 96
            .|.||..|:|
  Fly    77 VYTADETGYH 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 14/53 (26%)
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:459790 14/50 (28%)

Return to query results.
Submit another query.