powered by:
Protein Alignment Cpr72Ea and Cpr56F
DIOPT Version :9
Sequence 1: | NP_648882.1 |
Gene: | Cpr72Ea / 39814 |
FlyBaseID: | FBgn0036617 |
Length: | 341 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611470.1 |
Gene: | Cpr56F / 37299 |
FlyBaseID: | FBgn0034499 |
Length: | 217 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 15/58 - (25%) |
Similarity: | 23/58 - (39%) |
Gaps: | 10/58 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 QYIAKDELGQYSYGYSEPLSSKQETRTLDG-ITQGYYSYRDAAGKLQTVNYVADNKGF 95
:|..:|......:|:.| :.|| :..|.|......|:.|.|.|.||..|:
Fly 131 KYDVQDYESGNDFGHME---------SRDGDLAVGRYYVLLPDGRKQIVEYEADQNGY 179
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR12236 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.