DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and resilin

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster

Alignment Length:84 Identity:23/85 (27%)
Similarity:30/85 (35%) Gaps:21/85 (25%)


  Fly    40 YIAKDELGQYSYGYSEPLSSKQETRTLDG-ITQGYYSYRDAAGKLQTVNYVADNKGFHVAATNLP 103
            |..:|.....|:|:||         ..|| .|.|.|:.....|:.|.|.|.||.:|:.       
  Fly   349 YQVEDAPSGLSFGHSE---------MRDGDFTTGQYNVLLPDGRKQIVEYEADQQGYR------- 397

  Fly   104 KAKVPQESLEFSPRSASHP 122
                ||...|......|.|
  Fly   398 ----PQIRYEGDANDGSGP 412

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 16/47 (34%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:278791 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.