DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Cpr50Ca

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_610899.1 Gene:Cpr50Ca FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster

Alignment Length:361 Identity:75/362 (21%)
Similarity:121/362 (33%) Gaps:104/362 (29%)


  Fly    23 YAYTAEGSAVFTPTQRQYIAKDELGQYSYGYSEPLSSKQETRTLDGITQ-GYYSY--RDAAGKLQ 84
            :.||||.:.  .|||...:.   :.|:.....:||.:  |...:.|..| .|.||  :..|..|.
  Fly   459 HTYTAELAP--PPTQSVEVV---VPQFRPSKPDPLLA--EAPAIYGKPQEAYNSYELQPEASPLI 516

  Fly    85 TVNYVADNKGFHVAATNLPKAKVPQESLEFSPRSASHPVDHHVEHHAEVSHAVVQH--------- 140
            .:.|.|...|.:.....||:.:.....:..||....|.:.:.:   |:...|.:|.         
  Fly   517 KIEYHAQPDGINEHYKQLPEFQQLSTLIGKSPDDQIHGLTYLL---AKEMQAKLQRQGKQLVDRP 578

  Fly   141 -----PVGHHPIE----VPHHHTVVESGRSAHPDG----------HHP-VEHHEHRV-------- 177
                 |:..||.:    .|...|::|.|......|          :.| :|...:.|        
  Fly   579 QDSTAPILFHPGQGASPAPTLKTLLEHGSLGVQPGRLIGMAKTKQYVPIIEPGNNDVKELPAVPS 643

  Fly   178 -AVAQHPVGHHPVEVPHHHTVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHHHTVVE 241
             |.::.|.....::..|.|     |.|   :|:..|.:.|.||...:|.|.:..|....||.|: 
  Fly   644 SAASKLPTPSSYIDYTHGH-----GLS---NGYEGVTNAEEPVTTVEHVVHHPTVATQLHHQVL- 699

  Fly   242 SGRSAHPEVPHSIEHHEHPVSGSDPSGSHGGHSQLPHPVSDT---AEVAAAK---SLHLQRVHDE 300
                    :|....||               |.|..|.:..|   ||:.:.|   .||.....::
  Fly   700 --------LPKQQHHH---------------HQQQHHGLVATVLPAELDSDKGVNGLHFVNSDED 741

  Fly   301 GVRNQVLAKIPVAVARSHHVVVPAPVYGYTIPRYYT 336
            ....|..:|..               :||.|..::|
  Fly   742 KSLQQYASKYE---------------FGYRIRDFHT 762

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 13/49 (27%)
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.