DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:43 Identity:15/43 - (34%)
Similarity:21/43 - (48%) Gaps:1/43 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ITQGYYSYRDAAGKLQTVNYVADNKGFHVAATNLP-KAKVPQE 110
            :..|.|||:...|.|..|.|.||..||.....::| ...:|:|
  Fly    96 VQHGQYSYQSPEGTLVNVQYTADENGFRATGDHIPTPPAIPEE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 10/25 (40%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 10/25 (40%)

Return to query results.
Submit another query.