DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Cpr49Af

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_610775.1 Gene:Cpr49Af / 36352 FlyBaseID:FBgn0033729 Length:126 Species:Drosophila melanogaster


Alignment Length:69 Identity:21/69 - (30%)
Similarity:27/69 - (39%) Gaps:15/69 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GQYSYGYSEPLSSKQETRTLDGI------------TQGYYSYRDAAGKLQTVNYVADNKGFHVAA 99
            |:|.|.|.....||   .|.||:            ..|.||:....||...|:|.||..|:....
  Fly    33 GKYHYHYELKDGSK---ATQDGVLKSVNADHNGESVNGKYSFVADDGKTYVVSYTADENGYLAVG 94

  Fly   100 TNLP 103
            .:||
  Fly    95 DHLP 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 17/58 (29%)
Cpr49AfNP_610775.1 Chitin_bind_4 35..90 CDD:459790 17/57 (30%)

Return to query results.
Submit another query.