DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and CG16800

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609594.2 Gene:CG16800 FlyBaseID:FBgn0032462 Length:282 Species:Drosophila melanogaster

Alignment Length:299 Identity:60/300 (20%)
Similarity:90/300 (30%) Gaps:100/300 (33%)


  Fly     5 LLLLGSLSLAHGLALYYPYAYTAEGSAVFTPTQRQYIAKDELGQYSYGYSEPLSSKQETRTLDGI 69
            :.|||  .||..|||:            .||.....|:...|||....:                
  Fly     8 ITLLG--LLARALALH------------STPDGAMAISAALLGQDFEDF---------------- 42

  Fly    70 TQGYYSYRDAAGKLQTVNYVADNKGFHVAATNLPKAKVPQESLEFSPRSASHPVDHHVEH-HAEV 133
             |.|::::....:.|.           ||||.      .:|..|.....:..  :||.|| |.:.
  Fly    43 -QPYFAHKQEQEEDQL-----------VAATK------HEEHSEGGEEESGE--EHHSEHFHKKG 87

  Fly   134 SHAVVQHPVGHHPI--EVPHHHTVVESGRSAHPDGHHPVEHHEHRVAVAQHPVGHHPVEVPHHHT 196
            ..:...|..|.|..  |..||....:.|.....:||.  :.|:|..:               ||.
  Fly    88 GKSKKGHKHGEHSEKGEKGHHDKEGKKGEHGEEEGHE--KKHKHSES---------------HHK 135

  Fly   197 VVETGRSAHPDGHHPVEHHEHPVAVAQHPV-GNHPV-------------EVPHHHTVVESGRSAH 247
            ..:.|..    |....|..:|......|.: |.|.:             :..|:    |.|...|
  Fly   136 KKKKGSK----GEKGSEFEDHGSYKKGHSIKGKHNIHKLDENKKEKKFYDEDHN----EGGEEKH 192

  Fly   248 PEVPHSIEHHE--------HPVSGSDPSGSHGGHSQLPH 278
            .....|.:|.:        |...|.:.:....|||:..|
  Fly   193 GGFEESKKHKKGSSFKKGHHKKGGHEENYGKKGHSKKGH 231

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 3/46 (7%)
CG16800NP_609594.2 DUF4779 98..221 CDD:292628 26/148 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2ADEX
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.