DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Crys

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001285854.1 Gene:Crys FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster

Alignment Length:81 Identity:23/82 (28%)
Similarity:37/82 (45%) Gaps:6/82 (7%)


  Fly    44 DELGQYSYGYS--EPLS--SKQETRTLDG-ITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNL 102
            |...|||:.|.  :.|:  .|::....|| :.:|.||..:..|..:.|.|.||: .||:...:..
  Fly    72 DTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIVEYTADDVSGFNAIVSKQ 136

  Fly   103 PKAKVPQESLEFSPRS 118
            ...:..|:.|..|..|
  Fly   137 RLDEQQQQRLSASTSS 152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 16/52 (31%)
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49257
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.