DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Cpr30B

DIOPT Version :9

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:95 Identity:22/95 - (23%)
Similarity:37/95 - (38%) Gaps:29/95 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YYPYAYTAEGSAVFTPTQRQYIAKDELGQYSYGYSEP----LSSKQETRTLDGITQGYYSYRDAA 80
            |.|.||                      ::.:..::|    :.|::|:|..|.: :|.|...|:.
  Fly    28 YGPVAY----------------------EFQWSVNDPHTGDIKSQKESRKDDKV-EGVYELIDSD 69

  Fly    81 GKLQTVNYVA-DNKGFHVAATNLP-KAKVP 108
            |..:.|.|.| |:.||.......| ..|:|
  Fly    70 GYRRIVQYKADDHNGFEAIVQREPTDIKIP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 13/50 (26%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:278791 14/74 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.