DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and Cpr30B

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_609295.1 Gene:Cpr30B / 34270 FlyBaseID:FBgn0032125 Length:153 Species:Drosophila melanogaster


Alignment Length:95 Identity:22/95 - (23%)
Similarity:37/95 - (38%) Gaps:29/95 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YYPYAYTAEGSAVFTPTQRQYIAKDELGQYSYGYSEP----LSSKQETRTLDGITQGYYSYRDAA 80
            |.|.||                      ::.:..::|    :.|::|:|..|.: :|.|...|:.
  Fly    28 YGPVAY----------------------EFQWSVNDPHTGDIKSQKESRKDDKV-EGVYELIDSD 69

  Fly    81 GKLQTVNYVA-DNKGFHVAATNLP-KAKVP 108
            |..:.|.|.| |:.||.......| ..|:|
  Fly    70 GYRRIVQYKADDHNGFEAIVQREPTDIKIP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 13/51 (25%)
Cpr30BNP_609295.1 Chitin_bind_4 33..85 CDD:459790 14/74 (19%)

Return to query results.
Submit another query.