DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr72Ea and CG42367

DIOPT Version :10

Sequence 1:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_723502.2 Gene:CG42367 / 318998 FlyBaseID:FBgn0259713 Length:103 Species:Drosophila melanogaster


Alignment Length:71 Identity:22/71 - (30%)
Similarity:30/71 - (42%) Gaps:12/71 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DEL----GQYSYGY------SEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVADN-KGFHV 97
            |||    .||.:.|      |..:..:.|.|..:.:| |.||..|..|..:.|:|.||. .||:.
  Fly    30 DELIASPAQYEFHYSVHDSHSGDVKDQFEHRRGEYVT-GRYSLVDPDGHRRIVDYTADPLLGFNA 93

  Fly    98 AATNLP 103
            .....|
  Fly    94 QVRREP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 48..95 CDD:459790 16/53 (30%)
CG42367NP_723502.2 Chitin_bind_4 39..86 CDD:459790 13/47 (28%)

Return to query results.
Submit another query.