DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cpr72Ea and Cpr31A

Sequence 1:NP_648882.1 Gene:Cpr72Ea FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_995678.1 Gene:Cpr31A FlyBaseID:FBgn0053302 Length:340 Species:Drosophila melanogaster

Alignment Length:247 Identity:57/248 (23%)
Similarity:79/248 (32%) Gaps:69/248 (28%)


  Fly    49 YSYGYSEPLSS--KQETRTLD-GITQGYYSYRDAAGKLQTVNYVADN-KGFHVAATNLPKAKVPQ 109
            :|||..:.::.  |.:..|.| |...|.||..||.|..:||.|.||: .||:......|......
  Fly   137 FSYGVHDSITGDIKSQVETRDGGNVVGSYSVLDADGFKRTVTYTADDINGFNAVVQREPVVAARA 201

  Fly   110 ESLEFSPRSASHPVDHHVEHHAEVSHAVVQHPVGHHPIEVPHHHTVVESGRSAHPDGHHPVEHHE 174
            .:......||..||..|:.     |..|...|.   ||..||.....       |.....|.  |
  Fly   202 VAAPVVSVSAPAPVPVHIS-----SAPVASLPA---PIYYPHQQVFA-------PQQIQQVA--E 249

  Fly   175 HRVAVAQHPVGHHPVEVPHHHTVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHHHTV 239
            .:..|.:.||...|...|                 .|::::|                       
  Fly   250 QQGEVVESPVAQQPELEP-----------------TPIDYNE----------------------- 274

  Fly   240 VESGRSAHPEVPHSIEHHEHPVSGSDPSGSHGGHSQLPHPVSDTAEVAAAKS 291
               |:....|.    :...:|.....|..|..|.|. |.|.||.::|..|:|
  Fly   275 ---GQQQQQEQ----QQQTYPQDQQFPPYSPAGQSS-PAPDSDDSDVVEARS 318

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 19/50 (38%)
Cpr31ANP_995678.1 Chitin_bind_4 135..187 CDD:278791 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49437
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12236
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.