DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33060 and dpy-30

DIOPT Version :8

Sequence 1:NP_788513.2 Gene:CG33060 / 39807 FlyBaseID:FBgn0053060 Length:121 Species:Drosophila melanogaster
Sequence 2:NP_506058.1 Gene:dpy-30 / 179671 WormBaseID:WBGene00001088 Length:123 Species:Caenorhabditis elegans

Alignment Length:100 Identity:29/100 (29%)
Similarity:49/100 (49%) Gaps:23/100 (23%)


  Fly    15 PSPNKTKKN---PSAIISILCPDGDKPNKEAKPKKNGGSEEFQAKECPRTKSFKPPEERRIFLEQ 76
            |:..::.:|   ||.::|                .||| ::...:..||..|..|   .|.:|:.
 Worm    32 PAEAESNENTTVPSNVLS----------------ANGG-QQTGNQSAPRNTSTVP---TRQYLDS 76

  Fly    77 EVVPILMEGMLGLAREMPRDPIGYLQKFWLDDKHK 111
            .|||||::|:..||::.|.:||.:|..|.|.:|.:
 Worm    77 TVVPILLQGLGALAKDRPENPIEFLANFLLREKDR 111

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33060NP_788513.2 Dpy-30 71..110 CDD:253069 17/39 (44%)
dpy-30NP_506058.1 Dpy-30 69..110 CDD:253069 18/44 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002084
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23356
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.