DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13041 and CG34268

DIOPT Version :8

Sequence 1:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001097465.1 Gene:CG34268 / 5740141 FlyBaseID:FBgn0085297 Length:83 Species:Drosophila melanogaster

Alignment Length:128 Identity:42/129 (33%)
Similarity:52/129 (40%) Gaps:53/129 (41%)


  Fly     1 MFKFVAVIALLVATASA--GLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAVVQPV- 62
            ||:.:|||..|||.|.|  |.||.                                |..|| || 
  Fly     1 MFRIIAVIFALVAMAFAAPGYIEP--------------------------------SYGVV-PVA 32

  Fly    63 -VAPIVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSVPLVHSAPLVKSVVHSAPLAYTLHH 124
             |.|:||            :.|||..||||...|||.:||:|...|::||  ::.| .|. ||
  Fly    33 QVVPVVK------------SVPVVKHVPVVQHVPVVKNVPVVQHVPVLKS--YAVP-TYG-HH 79

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13041NP_648872.1 Retinin_C 25..>73 CDD:282395 9/50 (18%)
CG34268NP_001097465.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR34931
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.