DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13041 and CG13060

DIOPT Version :8

Sequence 1:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_648873.1 Gene:CG13060 / 39802 FlyBaseID:FBgn0036606 Length:131 Species:Drosophila melanogaster

Alignment Length:131 Identity:121/132 (92%)
Similarity:123/132 (93%) Gaps:7/132 (5%)


  Fly     1 MFKFVAVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAVVQPVVAP 65
            ||||:.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MFKFIGVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSITQVHSKAVVQPVVAP 65

  Fly    66 IVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSV---PLV----HSAPLVKSVVHSAPLAYTLH 123
            |||||||||||||||||||||||||||||||||||   |:|    ||||||||||||||||||||
  Fly    66 IVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSVHSAPVVHSVLHSAPLVKSVVHSAPLAYTLH 130

  Fly   124 H 124
            |
  Fly   131 H 131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13041NP_648872.1 Retinin_C 25..>73 CDD:282395 48/48 (100%)
CG13060NP_648873.1 Retinin_C 25..>73 CDD:282395 48/48 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131117975
eggNOG 1 0.900 E1_2FBKD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0010924
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR34931
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.