DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13062 and CG34268

DIOPT Version :9

Sequence 1:NP_648871.3 Gene:CG13062 / 39799 FlyBaseID:FBgn0036603 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_001097465.1 Gene:CG34268 / 5740141 FlyBaseID:FBgn0085297 Length:83 Species:Drosophila melanogaster


Alignment Length:116 Identity:27/116 - (23%)
Similarity:47/116 - (40%) Gaps:37/116 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLVVSLLSICALTAARPGFLHGHHHHYPEIPYYPHHHHVEPLHYHLPAAVSHQSSTVVHSVPH 65
            |.:::..:.::.|:..|.||:                   :||.:..:|.|   |...||.||| 
  Fly     1 MFRIIAVIFALVAMAFAAPGY-------------------IEPSYGVVPVA---QVVPVVKSVP- 42

  Fly    66 HIIKPVLLPTVVKTVVHPPIIK---AYHPAPIIKAYHPYDPFHLHHHHDFH 113
             ::|.      |..|.|.|::|   .....|::|:|    ....:.||.:|
  Fly    43 -VVKH------VPVVQHVPVVKNVPVVQHVPVLKSY----AVPTYGHHIYH 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13062NP_648871.3 Retinin_C 32..95 CDD:282395 17/65 (26%)
CG34268NP_001097465.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.