DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13062 and CG13041

DIOPT Version :8

Sequence 1:NP_648871.3 Gene:CG13062 / 39799 FlyBaseID:FBgn0036603 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster

Alignment Length:134 Identity:40/135 (30%)
Similarity:60/135 (44%) Gaps:36/135 (27%)


  Fly     1 MMKLVVSLLSICALTAARPGFLHGHHHHYPEIPYYPHHHHVEPLHYHLPAAVSHQSSTVVHSVPH 65
            |.|.|..:..:.|..:|  |.:..||     :.:.|....|..:.:..|:||||||.|.|||  .
  Fly     1 MFKFVAVIALLVATASA--GLIETHH-----VVHEPVLAKVGSVVHSAPSAVSHQSITQVHS--K 56

  Fly    66 HIIKPVLLPTVVKT--------------VVHP-PIIKA---------YHPAPIIKAYHPYDP--F 104
            .:::||:.| :|||              |||. |::.|         .|.||::|:.....|  :
  Fly    57 AVVQPVVAP-IVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSVPLVHSAPLVKSVVHSAPLAY 120

  Fly   105 HLHH 108
            .|||
  Fly   121 TLHH 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13062NP_648871.3 Retinin_C 32..95 CDD:282395 27/87 (31%)
CG13041NP_648872.1 Retinin_C 25..>73 CDD:282395 19/51 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR34931
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.