powered by:
                   
 
    
    
             
          
            Protein Alignment CG13062 and CG13041
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_648871.3 | Gene: | CG13062 / 39799 | FlyBaseID: | FBgn0036603 | Length: | 118 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_648872.1 | Gene: | CG13041 / 39801 | FlyBaseID: | FBgn0036605 | Length: | 124 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 134 | Identity: | 40/134 - (29%) | 
          
            | Similarity: | 60/134 -  (44%) | Gaps: | 36/134 - (26%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     1 MMKLVVSLLSICALTAARPGFLHGHHHHYPEIPYYPHHHHVEPLHYHLPAAVSHQSSTVVHSVPH 65|.|.|..:..:.|..:|  |.:..||     :.:.|....|..:.:..|:||||||.|.|||  .
 Fly     1 MFKFVAVIALLVATASA--GLIETHH-----VVHEPVLAKVGSVVHSAPSAVSHQSITQVHS--K 56
 
 
  Fly    66 HIIKPVLLPTVVKT--------------VVHP-PIIKA---------YHPAPIIKAYHPYDP--F 104.:::||:.| :|||              |||. |::.|         .|.||::|:.....|  :
 Fly    57 AVVQPVVAP-IVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSVPLVHSAPLVKSVVHSAPLAY 120
 
 
  Fly   105 HLHH 108.|||
 Fly   121 TLHH 124
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR34931 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 2.010 |  | 
        
      
           
             Return to query results.
             Submit another query.