DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13062 and CG4982

DIOPT Version :10

Sequence 1:NP_648871.3 Gene:CG13062 / 39799 FlyBaseID:FBgn0036603 Length:118 Species:Drosophila melanogaster
Sequence 2:NP_648866.1 Gene:CG4982 / 39794 FlyBaseID:FBgn0036598 Length:113 Species:Drosophila melanogaster


Alignment Length:115 Identity:45/115 - (39%)
Similarity:54/115 - (46%) Gaps:28/115 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMKLVVSLLSICA-LTAARPGFLHGHHHHYPEIPYYPHHHHVEPLHYHLPAAVSHQSSTVVHSVP 64
            |.|:|..|..:.| |..|||.:|..:.|    :.|.|.....|  .|.||||||||||||||.. 
  Fly     1 MFKVVFLLCGVFAVLIQARPSYLPSYEH----VEYAPSVVGYE--SYALPAAVSHQSSTVVHEK- 58

  Fly    65 HHIIKPVLLPTVVKTVVHPPIIK-AYHPAPIIKAYHP----------YDP 103
                :|...|    .|.|.||:| ||.||..| :|.|          |:|
  Fly    59 ----RPYWRP----IVDHTPILKAAYAPATSI-SYAPLGYAGNSAGWYEP 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13062NP_648871.3 Retinin_C 40..95 CDD:427994 27/55 (49%)
CG4982NP_648866.1 Retinin_C 36..82 CDD:427994 27/56 (48%)

Return to query results.
Submit another query.