DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13047 and CG13069

DIOPT Version :8

Sequence 1:NP_648862.2 Gene:CG13047 / 39790 FlyBaseID:FBgn0036594 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster

Alignment Length:154 Identity:56/155 (36%)
Similarity:66/155 (43%) Gaps:65/155 (42%)


  Fly     1 MYKFLVLA--ALIACSAAKPGVVAPLAAPLAAPLAYANAPLYAAGGSSQVDVRNNYDGTLSSYTT 63
            |:||..:|  |||||.|||||:|||||                                      
  Fly     1 MFKFFAVALFALIACVAAKPGIVAPLA-------------------------------------- 27

  Fly    64 APFEFAGPYSSRYVSGIPAAPAVVAKYAAAPLAAAYSAPLAAPVAAPLAAAP-VAAPLAAAPYAA 127
                    ||         ||.|    ||||.||.||.......|||..|:| ||:|..|:||.|
  Fly    28 --------YS---------APLV----AAAPAAAVYSREYHGNFAAPYVASPYVASPYVASPYVA 71

  Fly   128 AAYSAYPYASPYAAPYLASPYAAP 151
            :.|.|.||.   |:||:|:||.||
  Fly    72 SPYVASPYV---ASPYVAAPYTAP 92

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13047NP_648862.2 None
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 22/43 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.