DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13047 and CG12519

DIOPT Version :8

Sequence 1:NP_648862.2 Gene:CG13047 / 39790 FlyBaseID:FBgn0036594 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001262046.1 Gene:CG12519 / 40114 FlyBaseID:FBgn0036872 Length:131 Species:Drosophila melanogaster

Alignment Length:185 Identity:74/186 (40%)
Similarity:95/186 (51%) Gaps:69/186 (37%)


  Fly     1 MYK-FLVLAALIACSAAKPGVV-APLA--APLA--APLAY--------ANAPLYAAGGSSQVDVR 51
            |:| .:|:.|::||:|||||:: ||||  ||||  |||||        |.||:..| .|||| :.
  Fly     1 MFKSAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTA-TSSQV-IA 63

  Fly    52 NNYDGTLSSYTTAPFEFAGPYSSRYVSGIPAAPAVVAKYAAAPLAAAYSAPLAAPVAAPLAAAPV 116
            .||:|..::...||.               ||| |||||||        |||||||.|..||.|:
  Fly    64 RNYNGIAAAPVIAPV---------------AAP-VVAKYAA--------APLAAPVVAKYAATPL 104

  Fly   117 AAPLAAAPYAAAAYSAYPYASPYAAPYLASPYAAPYAASYAAPIAAAAP-APVVV 170
            |||||             |:||.|               |:||::.|.| ||:::
  Fly   105 AAPLA-------------YSSPLA---------------YSAPLSYAVPSAPLLI 131



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.