| Sequence 1: | NP_648862.2 | Gene: | CG13047 / 39790 | FlyBaseID: | FBgn0036594 | Length: | 170 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649112.1 | Gene: | CG14095 / 40112 | FlyBaseID: | FBgn0036870 | Length: | 162 | Species: | Drosophila melanogaster |
| Alignment Length: | 179 | Identity: | 88/179 - (49%) |
|---|---|---|---|
| Similarity: | 108/179 - (60%) | Gaps: | 36/179 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MYKF-LVLAALIACSAAKPGVV-APLAAPLAAPLAYANAPLYAAGGSSQVDVRNNYDGTLSSYTT 63
Fly 64 APFEFAGPYSSRYVSGIPAAPAVVAKYAAAPLAAAYSAPLAAPVAAPLA---AAPVAAPLAA--- 122
Fly 123 ---APYAAAAYSAYPYASPYAAPYLASPYAAPYAASYAAPIAAAAPAPV 168 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR35685 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||