DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13047 and CG14095

DIOPT Version :8

Sequence 1:NP_648862.2 Gene:CG13047 / 39790 FlyBaseID:FBgn0036594 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_649112.1 Gene:CG14095 / 40112 FlyBaseID:FBgn0036870 Length:162 Species:Drosophila melanogaster

Alignment Length:179 Identity:88/180 (49%)
Similarity:108/180 (60%) Gaps:36/180 (20%)


  Fly     1 MYKF-LVLAALIACSAAKPGVV-APLAAPLAAPLAYANAPLYAAGGSSQVDVRNNYDGTLSSYTT 63
            |:|: :|:.|||||.|||||:: .|||| |.||:..|.||:..| .||||..|     |.:....
  Fly     1 MFKYAVVICALIACVAAKPGLLHTPLAA-LPAPVIAAPAPVVTA-ASSQVVAR-----TFNGIAA 58

  Fly    64 APFEFAGPYSSRYVSGIPAAPAVVAKYAAAPLAAAYSAPLAAPVAAPLA---AAPVAAPLAA--- 122
            ||          .::.:|.|||.|.:..||||||..:||||||:.||..   ||||||||||   
  Fly    59 AP----------VIAQVPVAPAPVLRTVAAPLAAPLAAPLAAPLRAPAPVAFAAPVAAPLAAPIL 113

  Fly   123 ---APYAAAAYSAYPYASPYAAPYLASPYAAPYAASYAAPIAAAAPAPV 168
               ||:||      |.|:|:|||| |.|||||..|.||||: |.||||:
  Fly   114 NRVAPFAA------PIATPFAAPY-AHPYAAPVLAKYAAPL-AYAPAPL 154



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.