DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13047 and CG13068

DIOPT Version :8

Sequence 1:NP_648862.2 Gene:CG13047 / 39790 FlyBaseID:FBgn0036594 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_648856.1 Gene:CG13068 / 39784 FlyBaseID:FBgn0036588 Length:109 Species:Drosophila melanogaster

Alignment Length:149 Identity:56/150 (37%)
Similarity:70/150 (47%) Gaps:50/150 (33%)


  Fly     1 MYK---FLVLAALIACSAAKPGVVAPLAAPL--AAPLAYANAPLYAAGGSSQVDVRNNYDGTLSS 60
            |:|   .:||.||:|||:|:|......|||:  |||.....|.      |||             
  Fly     1 MFKLSALVVLCALVACSSAEPKPAILAAAPVVAAAPAGVVTAT------SSQ------------- 46

  Fly    61 YTTAPFEFAGPYSSRYVSGIPAAPAVVAKYAAAPLAAAYSAPLAAPVAAPLAAAPVAAPLAAAPY 125
                       |.:|..:|:.|||.|.|.|.|...||||:        ||:|||...||:     
  Fly    47 -----------YVARNFNGVAAAPVVAAAYTAPVAAAAYT--------APVAAAAYTAPV----- 87

  Fly   126 AAAAYSAYPYAS-PYAAPY 143
             ||||||||||: ||:|.|
  Fly    88 -AAAYSAYPYAAYPYSAAY 105



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.