DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13047 and 825-Oak

DIOPT Version :9

Sequence 1:NP_648862.2 Gene:CG13047 / 39790 FlyBaseID:FBgn0036594 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_730410.2 Gene:825-Oak / 317916 FlyBaseID:FBgn0052208 Length:129 Species:Drosophila melanogaster


Alignment Length:182 Identity:70/182 - (38%)
Similarity:93/182 - (51%) Gaps:65/182 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYKF-LVLAALIACSAAKPGVVAPLAAPLA--APLAY--------ANAPLYAAGGSSQVDVRNNY 54
            |:|: :|:.||:||:|||||:   |.||||  |||||        |.||:..| .|||| :..||
  Fly     1 MFKYAVVVLALVACAAAKPGL---LGAPLAYTAPLAYSAPAAVVAAPAPVVTA-TSSQV-IARNY 60

  Fly    55 DGTLSSYTTAPFEFAGPYSSRYVSGIPAAPAVVAKYAAAPLAAAYSAPLAAPVAAPLAAAPVAAP 119
            :|                                 .||||:.|..:|||||||.|..||.|:|||
  Fly    61 NG---------------------------------IAAAPVIAPVAAPLAAPVVAKYAATPLAAP 92

  Fly   120 LAAAPYAAAAYSAYPYASPYAAPYLASPYAAPYAASYAAPIA-AAAPAPVVV 170
            :      .|.|:|.|.|:..|       |::|.|  |:||:: ||||||.::
  Fly    93 V------VAKYAATPLAARLA-------YSSPLA--YSAPLSYAAAPAPFLI 129



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.