DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13047 and T06E4.12

DIOPT Version :8

Sequence 1:NP_648862.2 Gene:CG13047 / 39790 FlyBaseID:FBgn0036594 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_001024108.1 Gene:T06E4.12 / 179350 WormBaseID:WBGene00044011 Length:228 Species:Caenorhabditis elegans

Alignment Length:170 Identity:61/171 (36%)
Similarity:74/171 (43%) Gaps:40/171 (23%)


  Fly    15 AAKPGVVAPLAAPLAAPLAYANAPLYAAGGSSQVDVRNNYDGTLSSYTTAPFEFAGPYSSRYVSG 79
            |||| |:||..||:|||: .|.||...|                     ||.....|.:......
 Worm    39 AAKP-VLAPGVAPVAAPV-LAAAPTVLA---------------------APAPLLAPPAPLLAPP 80

  Fly    80 IPAAPAVVAKYAAAPLAAAYSAP-LAAPVAAPLAAAPV--AAPL--AAAP---YAAAAYSAYPYA 136
            .|...|..|..|.||:.||..|| ||||  ||..|.||  .||:  |.||   .||.|::..|..
 Worm    81 APVLAAAPAFAAPAPVFAAPPAPVLAAP--APFLAPPVPPVAPIVSAFAPRPVLAAPAFAPAPIL 143

  Fly   137 SP---YAAP----YLASPYAAPYAASYAAPIAAAAPAPVV 169
            :|   .|||    :..:|..||.....|..|.|.||||::
 Worm   144 APRPVLAAPAIPAFAPAPLLAPRPVLAAPAIPAFAPAPII 183



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_159766
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.