DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13068 and CG13051

Sequence 1:NP_648856.1 Gene:CG13068 FlyBaseID:FBgn0036588 Length:109 Species:Drosophila melanogaster
Sequence 2:NP_001097618.1 Gene:CG13051 FlyBaseID:FBgn0040799 Length:83 Species:Drosophila melanogaster

Alignment Length:99 Identity:45/100 (45%)
Similarity:54/100 (54%) Gaps:24/100 (24%)


  Fly     1 MFKLSALVVLCALVACSSAEPKPAILAAAPVVAAAPAGVVTATSSQYVARNFNGVAAAPVVAAAY 65
            |||..|.|:. ||.||.:|  ||.|:  ||:..:||     ..:|.|||..:   .|:|.|||.|
  Fly     1 MFKFVAAVIF-ALFACVAA--KPGIV--APLAYSAP-----YVASPYVASPY---VASPYVAAPY 52

  Fly    66 TAPVAAAAYTAPVAAAAYTAPVAAAYSAYPYAAY 99
            |     ||||     |||.||...||:| |||||
  Fly    53 T-----AAYT-----AAYAAPYTTAYTA-PYAAY 75



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.