DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4950 and AT4G13820

DIOPT Version :8

Sequence 1:NP_001261934.1 Gene:CG4950 / 39783 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_193118.2 Gene:AT4G13820 / 827016 AraportID:AT4G13820 Length:719 Species:Arabidopsis thaliana

Alignment Length:682 Identity:136/683 (20%)
Similarity:208/683 (30%) Gaps:303/683 (44%)


  Fly    26 GDIPLRCDEYDSMGYMDVNEAFCTVTGFTVTHSQNVVIK-NIP---------------------- 67
            |::|      ||||:::         ..|..|..:..:. |.|                      
plant   170 GELP------DSMGHLN---------KLTELHLGSAKLSGNFPSMLLNLSELTLIDLGSNQFGGM 219

  Fly    68 -PGNMVKFMKFYESTLLY-----------MPFHLFETFPYLKTL-----------------DVSN 103
             |.||....|     |:|           :|..|| ..|.|.:|                 ..||
plant   220 LPSNMSSLSK-----LVYFGIDRNSFSGSIPSSLF-MLPSLTSLVLGRNDFNGPLDFGNISSPSN 278

  Fly   104 TNILELTRNAF--------SAASNLTYLNLAYNNLT--SIQTSVFIGANVLMRLDLSY-NEISSL 157
            ..:|.|..|.|        |....|.||:|:..|..  .:..:.|:....|..||||| |..|.:
plant   279 LGVLSLLENNFNGPIPESISKLVGLFYLDLSLWNTKRGMVDFNTFLHLKSLTFLDLSYINTRSMV 343

  Fly   158 SVNAFCGLHTISQIYLTGNLLK----------------------ELHNDIFKDNE----YLEKVS 196
            .::.|..|.::..:.|:|..||                      |..|  |.:|:    ||:   
plant   344 DISIFSPLLSLGYLDLSGINLKISSTLSLPSPMGTLILSSCNIPEFPN--FLENQTTLYYLD--- 403

  Fly   197 FEGNLLTSIQPEVFRNMRRIKEVNLS--------------------------------------N 223
            ...|.:....|:...::..::.||:|                                      |
plant   404 ISANKIGGQVPQWLWSLPELQYVNISQNSFSGFEGPADVIQRCGELLMLDISSNTFQDPFPLLPN 468

  Fly   224 NRLIFIH---------PDTFADAASLENLVLSYNE--------LKNFQLTEKNIVHQLHLDNNYL 271
            :..||:.         |.|.....||:.||||.|.        .:.|..|    :..|||.||.|
plant   469 STTIFLGSDNRFSGEIPKTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTT----LSVLHLRNNNL 529

  Fly   272 TNLTINATRFVRASHNQISELFLHQSLHIETLDLSANKLSS--ISNITNITHMLYLDVSDNPIGP 334
            :.      .|...|   ||:       |:.:||:..|:||.  ..::.|.|.:.:|:|.||    
plant   530 SG------EFPEES---ISD-------HLRSLDVGRNRLSGELPKSLINCTRLEFLNVEDN---- 574

  Fly   335 LNISTFSQLKRLRGLNLRGTGIRELKFGMFSKQKYLEELDLSFNNLTILNLDMFVPYLTNLKK-- 397
                                                           |:| |.|..:|..|.|  
plant   575 -----------------------------------------------IIN-DKFPFWLRMLPKLQ 591

  Fly   398 -FLIDGNGLTELQG---NRTFSEAFPQLQKLGVSRNRFNCSYLHHLLIPPSLPESVVLNIEPDTN 458
             |::..|   |..|   :...|.:||:|:...:|.||||                          
plant   592 IFVLRSN---EFHGPISSLGDSLSFPKLRIFDISENRFN-------------------------- 627

  Fly   459 LDETPHIRDVSCISQSQEVVNASFTAEESKLESQIQMLSKQLDIVGSHSKNLELHLAFMQIFAYV 523
                             .|:.:.|.|..|.:.|.:.:    :||:.|.....:....:..:...|
plant   628 -----------------GVLRSDFFAGWSAMSSAVDI----VDIMPSRYAGRDSGNYYNSVTMTV 671

  Fly   524 MGGLV-LVGVVSLI--TLRYLKNQRSGRYDRS 552
            .|.:: |||.|..|  |:....|:..||...|
plant   672 KGSIIELVGSVFTIYKTIDVSGNRFEGRIPES 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380 9/48 (19%)
LRR_8 118..178 CDD:290566 18/63 (29%)
leucine-rich repeat 120..143 CDD:275380 6/25 (24%)
leucine-rich repeat 144..167 CDD:275380 10/24 (42%)
leucine-rich repeat 168..191 CDD:275380 8/49 (16%)
LRR_8 192..250 CDD:290566 18/113 (16%)
leucine-rich repeat 192..215 CDD:275380 3/23 (13%)
LRR_RI <207..432 CDD:238064 59/288 (20%)
leucine-rich repeat 216..239 CDD:275380 8/70 (11%)
leucine-rich repeat 240..299 CDD:275380 18/67 (27%)
LRR_8 299..356 CDD:290566 12/59 (20%)
leucine-rich repeat 300..321 CDD:275380 7/23 (30%)
leucine-rich repeat 322..345 CDD:275380 4/23 (17%)
LRR_8 344..405 CDD:290566 9/64 (14%)
leucine-rich repeat 346..365 CDD:275380 0/19 (0%)
leucine-rich repeat 370..394 CDD:275380 5/24 (21%)
leucine-rich repeat 395..420 CDD:275380 9/31 (29%)
AT4G13820NP_193118.2 LRRNT_2 31..78 CDD:285463
LRR_RI <79..216 CDD:238064 10/61 (16%)
LRR_8 109..168 CDD:290566
leucine-rich repeat 110..133 CDD:275380
leucine-rich repeat 134..157 CDD:275380
leucine-rich repeat 158..181 CDD:275380 6/26 (23%)
leucine-rich repeat 182..205 CDD:275380 4/23 (17%)
leucine-rich repeat 206..229 CDD:275380 3/23 (13%)
leucine-rich repeat 230..253 CDD:275380 6/24 (25%)
leucine-rich repeat 254..278 CDD:275380 3/24 (13%)
leucine-rich repeat 279..302 CDD:275380 5/23 (22%)
leucine-rich repeat 303..328 CDD:275380 6/25 (24%)
leucine-rich repeat 329..353 CDD:275380 10/24 (42%)
leucine-rich repeat 354..372 CDD:275380 4/18 (22%)
leucine-rich repeat 378..398 CDD:275380 4/22 (18%)
leucine-rich repeat 399..422 CDD:275380 4/26 (15%)
LRR_RI 419..>624 CDD:238064 55/280 (20%)
leucine-rich repeat 423..448 CDD:275380 3/25 (12%)
leucine-rich repeat 469..493 CDD:275380 4/24 (17%)
leucine-rich repeat 494..518 CDD:275380 7/24 (29%)
leucine-rich repeat 519..541 CDD:275380 10/38 (26%)
leucine-rich repeat 542..565 CDD:275380 7/23 (30%)
leucine-rich repeat 566..615 CDD:275380 18/104 (17%)
leucine-rich repeat 616..634 CDD:275380 7/61 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I2447
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.