DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4950 and chadla

DIOPT Version :8

Sequence 1:NP_001261934.1 Gene:CG4950 / 39783 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster
Sequence 2:XP_017210255.1 Gene:chadla / 565474 ZFINID:ZDB-GENE-121205-4 Length:791 Species:Danio rerio

Alignment Length:547 Identity:124/548 (23%)
Similarity:198/548 (36%) Gaps:192/548 (35%)


  Fly    99 LDVSNTNILELTRNAFSAASNLTYLNLAYNNLTSIQTSVFIGANVLMRLDLSYNEISSLSVNAFC 163
            ||:...|..||.:|||.....||.|:|...::.:::...|.|.:.|::|||:.|.|..|...:|.
Zfish    56 LDLKKNNFGELPKNAFKHTPYLTQLSLQGCSVQAVREGAFRGLSRLLQLDLTNNNIDILYQESFD 120

  Fly   164 GLHTISQIYLTGNLLKELHNDIFKDNEYLEKVSFEGNLLTSIQPEVFRNMRRIKEVNLSNNRLIF 228
            ||.::.|:||..|.::|:|...|.....|..:|...|.|..:....|:.|..|:.::||:|.|..
Zfish   121 GLSSLKQLYLDRNRIEEIHPGAFAALNS
LNLLSLTYNQLVYLPNMAFQGMMNIQMLHLSHNSLNN 185

  Fly   229 IHPDTFADAASLENLVLSYNELKNFQL-TEKNIVHQLHLDNNY---------------LTNLTIN 277
            :..:.||...:|.:|.|.:|||:.|.. |...::...|||.:|               ||:|:: 
Zfish   186 LATEAFAGLLALTHLNLDHNELQYFPTKTMTRLIEVTHLDMSYNPMTYLVEESVVMPKLTHLSL- 249

  Fly   278 ATRFVRASHN---QISELFLHQSLHIETLDLSANKLSSISNITNITHMLYLDVSDNPI------- 332
                   .||   .:||..:..|..|..||||.|:||.|..:...||:..|:::.|||       
Zfish   250 -------KHNALQDLSESTISLSPVISHLDLSFNQLSYIQALAASTHLTSLNLTGNPIRCTCLLR 307

  Fly   333 -------------------------GPL-----------------------------------NI 337
                                     .||                                   .:
Zfish   308 DLKLWALKSGIRLFGVCAWPPHLSDEPLENVQEQDLRCRPQDEWTSDVIEEGTKEEEEGVQEKTV 372

  Fly   338 STFSQLKR--------------------------------------LRG---------------- 348
            ||....|.                                      :||                
Zfish   373 STAKSKKTRKCPKDCLCEYAAQHATCENRGHTKVPSGFPRKTLLLDMRGNHFHYLPSKSFPGIPE 437

  Fly   349 ---LNLRGTGIRELKFGMFSKQKYLEELDLSFNNLTILNLDMF-----VPYLTNLKKFLIDGNGL 405
               |:|....|.|::.|.|...|.|..|.||.|.|:.|:..:|     :.||.      ::.|.|
Zfish   438 VVSLHLDSCKIHEIEGGAFQGMKNLIYLYLSDNQLSSLDAKVFEGAHEIMYLH------LEDNKL 496

  Fly   406 TELQGNRTFSEAFPQLQKLGVSRN---------------RFNCSYLHH----LLIPPSL---PES 448
            |....:.|.:. .|:|.:|.:.||               :....||::    .::|.:|   |:.
Zfish   497 THFPSSATLTH-IPKLLELHLERNLIAKLEPSGLLSPVLQLTGLYLNNNSIATIVPKALDPAPKL 560

  Fly   449 VVLNIE-------PDTNLDETPHIRDV 468
            .||::|       |...||..|.:.::
Zfish   561 DVLHLEDNVLTDVPSDALDHAPLLTEL 587

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380 8/20 (40%)
LRR_8 118..178 CDD:290566 20/60 (33%)
leucine-rich repeat 120..143 CDD:275380 6/23 (26%)
leucine-rich repeat 144..167 CDD:275380 10/23 (43%)
leucine-rich repeat 168..191 CDD:275380 7/23 (30%)
LRR_8 192..250 CDD:290566 18/58 (31%)
leucine-rich repeat 192..215 CDD:275380 6/23 (26%)
LRR_RI <207..432 CDD:238064 77/388 (20%)
leucine-rich repeat 216..239 CDD:275380 7/23 (30%)
leucine-rich repeat 240..299 CDD:275380 20/78 (26%)
LRR_8 299..356 CDD:290566 24/181 (13%)
leucine-rich repeat 300..321 CDD:275380 10/21 (48%)
leucine-rich repeat 322..345 CDD:275380 9/90 (10%)
LRR_8 344..405 CDD:290566 21/123 (17%)
leucine-rich repeat 346..365 CDD:275380 8/38 (21%)
leucine-rich repeat 370..394 CDD:275380 10/29 (34%)
leucine-rich repeat 395..420 CDD:275380 5/25 (20%)
chadlaXP_017210255.1 LRRNT 22..49 CDD:279764
leucine-rich repeat 55..76 CDD:275380 8/20 (40%)
LRR_8 75..135 CDD:290566 20/60 (33%)
leucine-rich repeat 77..100 CDD:275380 6/23 (26%)
leucine-rich repeat 101..124 CDD:275380 10/23 (43%)
leucine-rich repeat 125..148 CDD:275380 7/23 (30%)
leucine-rich repeat 149..172 CDD:275380 6/23 (26%)
LRR_8 172..231 CDD:290566 19/59 (32%)
leucine-rich repeat 173..196 CDD:275380 7/23 (30%)
leucine-rich repeat 197..220 CDD:275380 8/23 (35%)
leucine-rich repeat 221..243 CDD:275380 4/22 (18%)
LRR_8 242..300 CDD:290566 22/66 (33%)
leucine-rich repeat 244..267 CDD:275380 8/31 (26%)
leucine-rich repeat 417..437 CDD:275380 2/20 (10%)
LRR_8 436..496 CDD:290566 18/66 (27%)
leucine-rich repeat 438..461 CDD:275380 7/23 (30%)
LRR_RI <451..658 CDD:238064 34/145 (23%)
leucine-rich repeat 462..485 CDD:275380 8/23 (35%)
leucine-rich repeat 486..510 CDD:275380 7/31 (23%)
leucine-rich repeat 511..535 CDD:275380 4/24 (17%)
LRR_8 535..594 CDD:290566 12/54 (22%)
leucine-rich repeat 536..559 CDD:275380 5/23 (22%)
leucine-rich repeat 560..583 CDD:275380 7/23 (30%)
leucine-rich repeat 584..608 CDD:275380 0/5 (0%)
leucine-rich repeat 609..633 CDD:275380
leucine-rich repeat 634..656 CDD:275380
LRRCT 664..>699 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000238
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.