DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4950 and lingo1b

DIOPT Version :8

Sequence 1:NP_001261934.1 Gene:CG4950 / 39783 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001004576.1 Gene:lingo1b / 447837 ZFINID:ZDB-GENE-040912-136 Length:622 Species:Danio rerio

Alignment Length:577 Identity:128/578 (22%)
Similarity:217/578 (38%) Gaps:105/578 (18%)


  Fly    13 ILILAISS-CDGSGGDIPLRCDEYDSMGYMDVNEAFCTVTGFTVT-HSQNVVIKNIPPGNMV--K 73
            ||||.:.: ..||....|.||:              |:....:|. |.:.::  .:|.|..:  :
Zfish    28 ILILMLGTVLSGSATGCPSRCE--------------CSAQERSVVCHRRKLI--TLPEGIPIDTR 76

  Fly    74 FMKFYESTLLYMPFHLFETFPYLKTLDVSNTNILELTRNAFSAASNLTYLNLAYNNLTSIQTSVF 138
            .:...::.|..:....|..:|.|:.|.::...|..:...|||....|..|.|..|||..||..||
Zfish    77 LLDLSKNRLKAINPEEFLNYPQLEDLQLNENIISVIEPGAFSNLLGLRTLGLRNNNLKLIQLGVF 141

  Fly   139 IGANVLMRLDLSYNEISSLSVNAFCGLHTISQIYLTGNLLKELHNDIFKDNEYLEKVSFEGNLLT 203
            .|.:.|.|||:|.|:|..|....|..|:.:.::.:..|.|..:.:..|.....||:::.|...||
Zfish   142 TGLSNLTRLDISENKIVILLDYMFQELYNLKELEVGDNDLVFISHRAFHGLSSLEQLTMERCNLT 206

  Fly   204 SIQPEVFRNMRRIKEVNLSNNRLIFIHPDTFADAASLENLVLSYNELKNFQLTEKNIVHQLHLDN 268
            |:..|.|.::..:..:.|.:..:..|...:|.....|:.|     |:.|:.|.|......||   
Zfish   207 SVPTEAFSHLHNLLTLKLRHLNVNVIRDFSFRRLYRLKIL-----EIANWPLLESLTAKSLH--- 263

  Fly   269 NYLTNLTINATRFVRASHNQISELFLHQSLHIETLDLSANKLSSISNITNITHMLYL---DVSDN 330
                                        .|:|.||.::...|:::..:. |.|::||   ::|.|
Zfish   264 ----------------------------GLNITTLSITNCNLTAVPYVA-IQHLVYLRFFNLSFN 299

  Fly   331 PIGPLNISTFSQLKRLRGLNLRGTGIRELKFGMFSKQKYLEELDLSFNNLTILNLDMFVPYLTNL 395
            ||..:..:....|.||:..:|.|..:..::...|....||..|::|.|:|:.|....| ..:.||
Zfish   300 PIEVVEGNKMHNLLRLQAFHLVGGRLVSIEPYSFKGLNYLRVLNVSSNSLSTLEESAF-HSVGNL 363

  Fly   396 KKFLIDGNGLTELQGNRTFSEAFPQLQKLGVSRNRFNCSYLHHLLIPPSLPESVVLNIEPDTNLD 460
            :...:..|.|.            ...:.|.|.|.|:.                  ||........
Zfish   364 ETLALHDNPLA------------CDCRLLWVFRRRWR------------------LNFNRQQPSC 398

  Fly   461 ETPHIRDVSCISQSQEVVNAS-FTAEESKL-----------ESQIQMLSKQLDIVGSHSKNLELH 513
            |||............:|:..: ||.::||:           |........|.|  |..:..:...
Zfish   399 ETPEFLQGKEFKDFPDVLPPNYFTCQKSKIRDHKAIHRFVDEGTTVQFPCQAD--GDPTPMIMWQ 461

  Fly   514 LAFMQIFAYVMGGLVLVGVVSLITLRYLKNQRSGRYDRSSIVFRSNATMEANLTLGS 570
            ....|.......|.:.|.:...:.:||.:.|.:|.|...::....|.|..|:|.:.|
Zfish   462 SPKKQFITTKSIGRLSVSLDGTLEVRYAQIQDNGTYTCFAVNAGGNDTRLAHLHVHS 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380 6/23 (26%)
LRR_8 118..178 CDD:290566 22/60 (37%)
leucine-rich repeat 120..143 CDD:275380 11/23 (48%)
leucine-rich repeat 144..167 CDD:275380 10/23 (43%)
leucine-rich repeat 168..191 CDD:275380 3/23 (13%)
LRR_8 192..250 CDD:290566 14/58 (24%)
leucine-rich repeat 192..215 CDD:275380 8/23 (35%)
LRR_RI <207..432 CDD:238064 48/228 (21%)
leucine-rich repeat 216..239 CDD:275380 3/23 (13%)
leucine-rich repeat 240..299 CDD:275380 9/59 (15%)
LRR_8 299..356 CDD:290566 17/60 (28%)
leucine-rich repeat 300..321 CDD:275380 5/21 (24%)
leucine-rich repeat 322..345 CDD:275380 7/26 (27%)
LRR_8 344..405 CDD:290566 16/61 (26%)
leucine-rich repeat 346..365 CDD:275380 4/19 (21%)
leucine-rich repeat 370..394 CDD:275380 7/24 (29%)
leucine-rich repeat 395..420 CDD:275380 3/25 (12%)
lingo1bNP_001004576.1 LRRNT 43..77 CDD:214470 8/50 (16%)
LRR 1 74..95 2/21 (10%)
leucine-rich repeat 75..98 CDD:275380 3/23 (13%)
LRR_8 76..133 CDD:290566 14/57 (25%)
LRR_RI 78..>315 CDD:238064 67/274 (24%)
LRR 2 98..119 6/21 (29%)
leucine-rich repeat 99..146 CDD:275380 17/47 (36%)
LRR 3 122..143 10/21 (48%)
LRR_8 130..181 CDD:290566 19/51 (37%)
LRR 4 146..167 9/21 (43%)
leucine-rich repeat 147..170 CDD:275380 10/23 (43%)
LRR_8 170..226 CDD:290566 12/56 (21%)
LRR 5 170..191 3/21 (14%)
leucine-rich repeat 171..194 CDD:275380 3/23 (13%)
LRR 6 194..215 8/21 (38%)
leucine-rich repeat 195..218 CDD:275380 8/23 (35%)
LRR 7 218..239 3/21 (14%)
leucine-rich repeat 219..242 CDD:275380 3/23 (13%)
leucine-rich repeat 243..290 CDD:275380 15/84 (18%)
LRR_8 266..325 CDD:290566 17/60 (28%)
LRR 8 266..287 5/22 (23%)
LRR 9 290..311 6/21 (29%)
leucine-rich repeat 291..338 CDD:275380 11/47 (23%)
LRR_8 314..373 CDD:290566 16/60 (27%)
LRR 10 314..335 5/21 (24%)
LRR 11 338..359 8/22 (36%)
leucine-rich repeat 339..362 CDD:275380 7/24 (29%)
TPKR_C2 371..424 CDD:301599 14/83 (17%)
IG_like 438..516 CDD:214653 16/80 (20%)
Ig 441..516 CDD:299845 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000238
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.