DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4950 and kek6

DIOPT Version :8

Sequence 1:NP_001261934.1 Gene:CG4950 / 39783 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001263151.1 Gene:kek6 / 43729 FlyBaseID:FBgn0039862 Length:843 Species:Drosophila melanogaster

Alignment Length:299 Identity:68/300 (23%)
Similarity:122/300 (41%) Gaps:54/300 (18%)


  Fly    96 LKTLDVSNTNILELTRNAFSAAS--NLTYLNLAYNNLTSIQTSVFIGANVLMRLDLSYNEISSLS 158
            |:.|.:::.:|..|.|..||...  ||..:.|..:.:..|....|....:|:.:|||.|::..|.
  Fly    71 LQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLD 135

  Fly   159 VNAFCGLHTISQIYLTGNLLKELHNDIFKDNEYLEKVSFEGNLLTSIQPEVFRNMRRIKEVNLSN 223
            .:.|.|...:..:||.||.||.|....|....:|..:.....|::.|.|....|:..::.:||.|
  Fly   136 KDTFMGNDRLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLANLNLLEFLNLKN 200

  Fly   224 NRLIFIHPDTFADAASLENLVLSYN------ELKNF-------QLTEKNIV-------------- 261
            |.|..:....|...|:|:.|.|..|      :|:.|       :|:..::|              
  Fly   201 NLLESLSEYVFQHMANLKTLSLEENPWQCNCKLRKFRGWYVNSRLSSVSLVCKGPPAQKDRTWDS 265

  Fly   262 --HQLH--------LDNNYLTNLTI--NATRFVRASHNQISE--------LFLHQSLHIETLDLS 306
              .:|.        .:|..:.|:.|  |.|.......:.:.|        :..:.::..|:..::
  Fly   266 VDDELFGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAWELNGKILDNDNVLFESESIA 330

  Fly   307 ANKLSS---ISNITNITHMLYLDVSDNPIGPL--NISTF 340
            ::||.|   :.|:|::....|.....|.||.:  |||.:
  Fly   331 SDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNISIY 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380 7/25 (28%)
LRR_8 118..178 CDD:290566 17/62 (27%)
leucine-rich repeat 120..143 CDD:275380 4/23 (17%)
leucine-rich repeat 144..167 CDD:275380 8/23 (35%)
leucine-rich repeat 168..191 CDD:275380 8/23 (35%)
LRR_8 192..250 CDD:290566 16/64 (25%)
leucine-rich repeat 192..215 CDD:275380 5/23 (22%)
LRR_RI <207..432 CDD:238064 37/187 (20%)
leucine-rich repeat 216..239 CDD:275380 7/23 (30%)
leucine-rich repeat 240..299 CDD:275380 15/106 (14%)
LRR_8 299..356 CDD:290566 13/48 (27%)
leucine-rich repeat 300..321 CDD:275380 6/24 (25%)
leucine-rich repeat 322..345 CDD:275380 7/22 (32%)
LRR_8 344..405 CDD:290566
leucine-rich repeat 346..365 CDD:275380
leucine-rich repeat 370..394 CDD:275380
leucine-rich repeat 395..420 CDD:275380
kek6NP_001263151.1 leucine-rich repeat 71..96 CDD:275380 7/25 (28%)
LRR_8 96..155 CDD:290566 17/59 (29%)
leucine-rich repeat 97..120 CDD:275380 4/23 (17%)
leucine-rich repeat 121..144 CDD:275380 8/23 (35%)
LRR_4 144..186 CDD:289563 12/42 (29%)
leucine-rich repeat 145..168 CDD:275380 8/23 (35%)
leucine-rich repeat 169..216 CDD:275380 12/47 (26%)
LRRCT 225..274 CDD:214507 6/49 (12%)
Ig 295..367 CDD:143165 14/72 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C19499797
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.