DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4950 and lingo1

DIOPT Version :8

Sequence 1:NP_001261934.1 Gene:CG4950 / 39783 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001093719.1 Gene:lingo1 / 100101739 XenbaseID:XB-GENE-921957 Length:606 Species:Xenopus tropicalis

Alignment Length:435 Identity:110/436 (25%)
Similarity:183/436 (42%) Gaps:75/436 (17%)


  Fly    12 VILILAISSCDGSGGDIPLRCD--EYD------SMGYMDVNEAFCTVTGFTVTHSQNVVIKNIPP 68
            ::||:..|...||....|.|||  ..|      ...|:||.|...|.|.......          
 Frog    12 ILLIVVGSILSGSASGCPQRCDCSPQDRSVLCHRKRYLDVPEGIPTDTRLLDLSK---------- 66

  Fly    69 GNMVKFMKFYESTLLYMPFHLFETFPYLKTLDVSNTNILELTR-NAFSAASNLTYLNLAYNNLTS 132
             |.:|.:...|          |..||||:.|:: |.||:.:.. .||:...||..|.|..|.|..
 Frog    67 -NRIKALNQDE----------FSAFPYLEELEL-NENIVSIIEPGAFNGLFNLRSLGLRSNRLKL 119

  Fly   133 IQTSVFIGANVLMRLDLSYNEISSLSVNAFCGLHTISQIYLTGNLLKELHNDIFKDNEYLEKVSF 197
            |...||.|.:.|.:||:|.|:|..|..:.|..|:.:..:.:..|.|..:.:..|:....||:::.
 Frog   120 IPLGVFTGLSNLTQLDISENKIVILLDDMFQDLYNLKSLEVGDNDLVYISHRAFRGLNSLEELTL 184

  Fly   198 EGNLLTSIQPEVFRNMRRIKEVNLSNNRLIFIHPDTFADAASLENLVLSYNELKNFQLTEKNIVH 262
            |...|||:..|...::..:..:.|   |.:.|            |::..|:..:.::|....|.|
 Frog   185 EKCNLTSVPTEALSHLHGLITLKL---RYLNI------------NVIRDYSFKRLYRLKNLEIAH 234

  Fly   263 QLHLDNNYLTNLTINATRFVRASHNQISELFLHQSLHIETLDLSANKLSSISNITNITHMLY--- 324
            ..:||     .:|.|..                ..|::.:|.::.:.||||..:. |.|::|   
 Frog   235 WPYLD-----TMTSNGL----------------YGLNLTSLSITHSNLSSIPYVA-IRHLVYLRF 277

  Fly   325 LDVSDNPIGPLNISTFSQLKRLRGLNLRGTGIRELKFGMFSKQKYLEELDLSFNNLTILNLDMFV 389
            |::|.|||..:..|...:|.||:..:|.|..:..::...|....:|:.|::|.|.|:.|....| 
 Frog   278 LNLSYNPITAVEGSMLYELLRLQEFHLVGGQLSVVEPYAFRGLNHLKVLNVSSNYLSTLEESSF- 341

  Fly   390 PYLTNLKKFLIDGNGLTELQGNRTFSEAFPQLQKLGVSRNRFNCS 434
            ..:.||:..::|.|   .|..:......|.:..:|..||.:.:||
 Frog   342 HSVGNLETLILDKN---PLACDCRLLWIFRRRWRLNFSRQQPSCS 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380 7/24 (29%)
LRR_8 118..178 CDD:290566 20/60 (33%)
leucine-rich repeat 120..143 CDD:275380 9/23 (39%)
leucine-rich repeat 144..167 CDD:275380 9/23 (39%)
leucine-rich repeat 168..191 CDD:275380 3/23 (13%)
LRR_8 192..250 CDD:290566 12/58 (21%)
leucine-rich repeat 192..215 CDD:275380 7/23 (30%)
LRR_RI <207..432 CDD:238064 50/228 (22%)
leucine-rich repeat 216..239 CDD:275380 3/23 (13%)
leucine-rich repeat 240..299 CDD:275380 10/59 (17%)
LRR_8 299..356 CDD:290566 19/60 (32%)
leucine-rich repeat 300..321 CDD:275380 6/21 (29%)
leucine-rich repeat 322..345 CDD:275380 8/26 (31%)
LRR_8 344..405 CDD:290566 16/61 (26%)
leucine-rich repeat 346..365 CDD:275380 4/19 (21%)
leucine-rich repeat 370..394 CDD:275380 7/24 (29%)
leucine-rich repeat 395..420 CDD:275380 5/25 (20%)
lingo1NP_001093719.1 LRRNT 27..61 CDD:214470 11/34 (32%)
LRR 1 58..79 5/42 (12%)
leucine-rich repeat 59..82 CDD:275380 7/44 (16%)
PLN00113 62..>381 CDD:331614 92/382 (24%)
LRR 2 82..103 8/22 (36%)
leucine-rich repeat 83..106 CDD:275380 7/24 (29%)
LRR 3 106..127 9/21 (43%)
leucine-rich repeat 107..130 CDD:275380 9/23 (39%)
LRR 4 130..151 8/21 (38%)
leucine-rich repeat 131..154 CDD:275380 9/23 (39%)
LRR 5 154..175 3/21 (14%)
leucine-rich repeat 155..178 CDD:275380 3/23 (13%)
LRR 6 178..199 7/21 (33%)
leucine-rich repeat 179..250 CDD:275380 20/107 (19%)
LRR 7 202..223 5/36 (14%)
leucine-rich repeat 203..226 CDD:275380 5/38 (13%)
LRR 8 250..271 6/22 (27%)
leucine-rich repeat 251..274 CDD:275380 7/24 (29%)
LRR 9 274..295 7/21 (33%)
leucine-rich repeat 275..298 CDD:275380 7/23 (30%)
LRR 10 298..319 5/21 (24%)
leucine-rich repeat 299..322 CDD:275380 4/23 (17%)
LRR 11 322..343 7/22 (32%)
leucine-rich repeat 323..343 CDD:275380 7/21 (33%)
Ig 425..500 CDD:325142
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000238
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.