DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED10 and MED10

DIOPT Version :10

Sequence 1:NP_648849.3 Gene:MED10 / 39777 FlyBaseID:FBgn0036581 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_115662.2 Gene:MED10 / 84246 HGNCID:28760 Length:135 Species:Homo sapiens


Alignment Length:129 Identity:78/129 - (60%)
Similarity:101/129 - (78%) Gaps:1/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPLENLETQLEMFIENVRQIRIIVSDFQPQGQNVLNQKINSLVTGLQEIDKLRSQVQDVYVPF 65
            |:...::||..||.|:||:||:.||||||||..|..||||:|.:|||||:|||.|.|:.|:.||.
Human     1 MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPL 65

  Fly    66 EVFFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKIEGLKKFKTNLLLELYKTFPNEMNNYRAYR 129
            || |:||||.:|||||||:|:|:||||||:|||||:.:||||:.|:.||.|.||.:|..||:.|
Human    66 EV-FEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIR 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED10NP_648849.3 Med10 9..127 CDD:462879 74/117 (63%)
MED10NP_115662.2 Med10 9..126 CDD:462879 73/116 (63%)

Return to query results.
Submit another query.