DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elg1 and rfc1

DIOPT Version :8

Sequence 1:NP_996103.1 Gene:elg1 / 39770 FlyBaseID:FBgn0036574 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_001082960.2 Gene:rfc1 / 100037336 ZFINID:ZDB-GENE-070410-99 Length:1147 Species:Danio rerio

Alignment Length:1235 Identity:262/1236 (21%)
Similarity:438/1236 (35%) Gaps:323/1236 (26%)


  Fly    17 TTASPPGTPSKNAATD--------PVEPTSPFVLRAP-----PSAKSK--LILQNMEEVLNSVKQ 66
            |:..|....:.|.:|.        ..:.:.|.| ::|     ||.|.|  :|:.:..|....||.
Zfish     8 TSTKPVAQKASNGSTSTSTDEEQKKKQKSRPKV-KSPKSDEKPSGKRKKRVIVDSDSEEEKKVKT 71

  Fly    67 KHREKHKRKREEKRRAALM---EDQKSTTEEVKANAKEKPQPLREKSSQENGLKNGRRRSSPLK- 127
            |...|......||:.....   .|...|.|.:|     ||:|      :|||...|::.|...| 
Zfish    72 KKSTKETSIPTEKKHPVTYVSDSDSDGTFETLK-----KPKP------KENGTAKGKKESDSGKA 125

  Fly   128 -------SSTPVADNQSIMKHFAKAGKPENVGVSP-VSTAKPKP-TTNVFEFMMNARNRSLGVNE 183
                   |.:|| .:.|.:|...|:.:|.   ||| |:...||. .|:|..|.            
Zfish   126 KQVKVSSSKSPV-KSPSTVKGGVKSSQPT---VSPKVAPTPPKQMPTSVMAFF------------ 174

  Fly   184 GGAESPADQEIGSEAATPTTKRKLLLQEWNERKGGAKRRLADEARGEFIELQMEQRAKRLRKMLT 248
             |:.|....| ....|:.:||||..|:        ....|:|||..:  ||||:: .|.|.|.:.
Zfish   175 -GSSSVQRSE-KKMVASSSTKRKAPLE--------TDESLSDEAIAK--ELQMDE-DKELEKQIH 226

  Fly   249 KTD--AKEVTAPSSAPTDPTVKRLRGRPRSRRISSMD---AQNQIVES--KPPVVKAKDQDPGTE 306
            ..:  |:.:.....||.          |:..|:.|:.   :.:|.:.|  ||    .||..|.|.
Zfish   227 DDEEFARTLAMLDDAPL----------PKKARVDSISPSKSSSQAIASDIKP----KKDLSPKTS 277

  Fly   307 EL-----LSKLSSPTKKRDSLLGYFPKVESPKELAEKVI-IAIETPPME-TPKRRTLRRKSQQET 364
            .:     |:::....::||.        :..|:..||.| |:.:..|:. |...|....|:...:
Zfish   278 PVKTSSKLAQMKRRQEERDE--------QGKKDKGEKQIKISPKKEPISPTSSERAATPKTASAS 334

  Fly   365 PIVAESTPSSRPRRSCVGKARYDYDLETSPGKQQKAKP-----QKADESVEIIDLDNSNPAATPK 424
            ..:|:|...|.|:...|..       :|||.|.:...|     ::|:.|.....|:...|.|...
Zfish   335 AGMAKSRNLSTPKSESVPS-------KTSPTKPENTSPDDLEKKRANSSAYRSYLNREGPRALGS 392

  Fly   425 KLAPLFVRQLPKPSPDPSVLKARQAFLQSGVPDKIRQEQIRQKNFDQMY----------EDSYEV 479
            |         ..|..:.:.|:. ..|:.:||.:.:.:::  .|:..:.|          :.:|.|
Zfish   393 K---------DIPQGEENCLEG-CVFVLTGVLESMERDE--AKSLIERYGGKVTGNVSRKTTYLV 445

  Fly   480 FPRLAHIG----CESFGSKNGPLDIPFALRAEEEYSEVTKALPANKRRAKASSITSCLPADFTSS 540
            ..|.:.:.    .||||:|         :..|:|..::.:..|..|.:.:.::     .|:..||
Zfish   446 LGRDSGVSKTEKAESFGTK---------IINEDELLDLIRTKPGKKSKYEIAA-----EAENKSS 496

  Fly   541 KTLNKFNYATLPQLENKRGFVKLWKNDFDRFPTFKCYNQMREKYRHFSAIDSAQDTQQMGESLVV 605
            ||          :..:.||  |:..:.....|.....|: |......|...||..:...|.|...
Zfish   497 KT----------RTPDSRG--KVASSAKKATPQGPSPNK-RSSSGGKSKPGSASKSGARGASCSE 548

  Fly   606 TRRTRRSMEQNMAQNEEEAKP-PPSAPNGE---LLFTEKYKPLLFEQVLVNLTPVQ-------EL 659
            .::: .|.:|.     :.|.| ..|||..:   ||:.:||:|    :.|.||...|       :|
Zfish   549 VKKS-LSFDQT-----KTASPVSHSAPENDGSSLLWVDKYRP----RSLKNLIGQQGDQSCANKL 603

  Fly   660 REFLSSW----SGNGGSNRNSQGMDDTFDMSNDSASMGSSSNTMVLVGPSSSGKTNAVFTLANDM 720
            ..:|.||    |||..:.....|   .|...:|    ||.....:|.||...|||.....:..::
Zfish   604 LRWLQSWHKHHSGNAKAPAPKFG---KFGSKDD----GSGFKAALLSGPPGVGKTTTAALVCEEL 661

  Fly   721 NFNVLEINAGMKRTGKKLIQELQEATQSHQIRKDGKAGGGSSQQLLQKLQKSGLKAKAAAVEPPS 785
            .::.:|:||...|:...|.:.:.|:..:..|:   ....|:||.:..                  
Zfish   662 GYSYVEMNASCTRSKNSLKEVIAESLNNTSIK---NFYTGASQTVSS------------------ 705

  Fly   786 EVRKSLILIEDADILFDNLDAGFTDAIYTLAASSKRPVIVVATDPNCAHLQRLMQQNI-IHFQAP 849
               |.::::::.|.:..|.|.|....:..|...||.|:|.:..|.|...::.|..... :.||.|
Zfish   706 ---KHVLIMDEVDGMAGNEDRGGIQEMIGLIKQSKIPIICMCNDRNHQKIRSLANYCYDLRFQRP 767

  Fly   850 NALNISRFLAVLSLMENCPIELDELISVYLYNQQNLRKTLMELQFYIQSGGDSTRDRTGGGIKSP 914
            ....|...:..::..|...|....|..|.|.:.|::|:.|..|..:.......|.|:......:.
Zfish   768 RVEQIKGAMMSIAFKEGLKIPPPALNEVILASNQDIRQVLHNLSMWSAKDKVMTYDQAKADANNA 832

  Fly   915 TK-----------------TSNSRLATVDGSRIHQRFFEFFTSPQNVQYRIPFPVDFSLLRLNLP 962
            .|                 ...:.::.:|.|.:   ||.                |:|     |.
Zfish   833 KKDMKLGPFDVCRKVFALGEETAHMSLIDKSDL---FFH----------------DYS-----LA 873

  Fly   963 DLMASSAMLKEQQAAGGGSRTAAKRKSRSPKKAWLSSATGQKSDGHSSSLATLASFYDNISVASL 1027
            .|......|..:.||.||:.                          .|.|..|:...|:|....|
Zfish   874 PLFVQENYLHVRPAAAGGNL--------------------------KSHLVLLSKTADSICDGDL 912

  Fly  1028 MDSDCSDRLQWHLSEEIGHLLVEQALQTGLATKE------CPYNLFDKPVQRFS----------- 1075
            :|.....:..|       .||..||:...:...|      ..:..|...:.:||           
Zfish   913 VDRQIRSKQTW-------SLLPTQAIYASVLPGELMRGYMSQFPNFPSWLGKFSSSGKHSRIIQE 970

  Fly  1076 ICQHLGNGVLRSDSAKSLDFEPALRSICRSEKERAGLERKSSRF-----YHYLRNHTVNVTSFTT 1135
            :..|:....|.|..|.:||:.|.|||......:..|.|..:...     |..::....|:...:|
Zfish   971 LASHMSLKTLSSKEAVNLDYLPYLRSAVLKPLQSLGSEGANQSVKLMDDYDIIKEDVDNMMEIST 1035

  Fly  1136  1135
            Zfish  1036  1035

Known Domains:


GeneSequenceDomainRegion External IDIdentity
elg1NP_996103.1 Selenoprotein_S <57..129 CDD:284376 21/83 (25%)
P-loop_NTPase 699..828 CDD:304359 26/129 (20%)
rfc1NP_001082960.2 BRCT 405..476 CDD:237994 15/83 (18%)
PRK04195 576..1131 CDD:235250 110/553 (20%)
AAA 641..768 CDD:278434 32/151 (21%)
RFC1 907..1060 CDD:285691 27/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5275
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.