DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs20 and Trappc2

DIOPT Version :8

Sequence 1:NP_648841.1 Gene:Trs20 / 39769 FlyBaseID:FBgn0266724 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_079708.2 Gene:Trappc2 / 66226 MGIID:1913476 Length:140 Species:Mus musculus

Alignment Length:137 Identity:79/138 (57%)
Similarity:108/138 (78%) Gaps:0/138 (0%)


  Fly     3 TYYFVIVGQNDNPIYEKEFSTVNKELRKEDHRHLTQFIAHAALDLVDEHKWKTANMQLKSIDRFN 67
            ::||||||.:|||::|.||....|...|:|||||.|||||||||||||:.|.:.||.||::|:||
Mouse     4 SFYFVIVGHHDNPVFEMEFLPPGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFN 68

  Fly    68 QWFVSAFITASQIRFIIVHDNKNDEGIKNFFNEMYDTYIKNSMNAFYRINTPIKSPMFEKKSEIF 132
            :||||||:||..:|||::||.:.::||||||.::||.|||.:||.||..|:||:|..|::|.:..
Mouse    69 EWFVSAFVTAGHMRFIMLHDVRQEDGIKNFFTDVYDLYIKFAMNPFYEPNSPIRSSAFDRKVQFL 133

  Fly   133 GRKYLLS 139
            |:|:|||
Mouse   134 GKKHLLS 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs20NP_648841.1 Sedlin_N 8..135 CDD:282482 72/127 (57%)
Trappc2NP_079708.2 TRAPPC2_sedlin 4..138 CDD:341429 76/134 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C230414612
eggNOG 1 0.900 E1_COG5603
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H5436
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1426075at2759
OrthoFinder 1 1.000 FOG0002499
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128381
Panther 1 1.100 LDO PTHR12403
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1554
TreeFam 1 0.960
109.840

Return to query results.
Submit another query.