DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs20 and TRAPPC2

DIOPT Version :8

Sequence 1:NP_648841.1 Gene:Trs20 / 39769 FlyBaseID:FBgn0266724 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001122307.2 Gene:TRAPPC2 / 6399 HGNCID:23068 Length:174 Species:Homo sapiens

Alignment Length:137 Identity:80/138 (58%)
Similarity:108/138 (78%) Gaps:0/138 (0%)


  Fly     3 TYYFVIVGQNDNPIYEKEFSTVNKELRKEDHRHLTQFIAHAALDLVDEHKWKTANMQLKSIDRFN 67
            ::||||||.:|||::|.||....|...|:|||||.|||||||||||||:.|.:.||.||::|:||
Human    38 SFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFN 102

  Fly    68 QWFVSAFITASQIRFIIVHDNKNDEGIKNFFNEMYDTYIKNSMNAFYRINTPIKSPMFEKKSEIF 132
            :||||||:||..:|||::||.:.::||||||.::||.|||.|||.||..|:||:|..|::|.:..
Human   103 EWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFL 167

  Fly   133 GRKYLLS 139
            |:|:|||
Human   168 GKKHLLS 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Trs20NP_648841.1 Sedlin_N 8..135 CDD:282482 73/127 (57%)
TRAPPC2NP_001122307.2 Sedlin_N 43..170 CDD:309669 73/127 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5603
Hieranoid 1 1.000
Homologene 1 1.000 H5436
Inparanoid 1 1.050 181 1.000 Inparanoid score I3927
Isobase 1 0.950 0 Normalized mean entropy S776
OMA 1 1.010
OrthoDB 1 1.010 D1426075at2759
OrthoFinder 1 1.000 FOG0002499
OrthoInspector 1 1.000 T610113
orthoMCL 1 0.900 OOG5_128381
Panther 1 1.100 LDO PTHR12403
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1554
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.