DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and ATP2

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_012655.3 Gene:ATP2 SGDID:S000003882 Length:511 Species:Saccharomyces cerevisiae

Alignment Length:467 Identity:339/468 (72%)
Similarity:390/468 (83%) Gaps:3/468 (1%)


  Fly   104 GVIHAVIGPVIDVYFEE-EVPEVLNALQVQDAPIANLVLEVFHHLGNNIVRCVAMDSTEGLRRGQ 167
            |.:.||||.::||:||: |:|.:||||::: .|...|||||..|||.|.||.:|||.||||.||:
Yeast    44 GKVTAVIGAIVDVHFEQSELPAILNALEIK-TPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRGE 107

  Fly   168 PVLDTGYPIRVAVGKAVLGRILNVVGDPIDDRGEVKSDFYSFIHNEAPELTDLSVKPEILVTGIK 232
            .|||||.||.|.||:..||||:||:|:|||:||.:||.....||.:.|...:.|...|||.||||
Yeast   108 KVLDTGGPISVPVGRETLGRIINVIGEPIDERGPIKSKLRKPIHADPPSFAEQSTSAEILETGIK 172

  Fly   233 VIDLLAPYVKGGKIGLFGGAGVGKTVLIMELINNIAKSHGGYSVFVGAGERTREGNDLYHEMIES 297
            |:||||||.:||||||||||||||||.|.||||||||:|||:|||.|.|||||||||||.||.|:
Yeast   173 VVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERTREGNDLYREMKET 237

  Fly   298 KVISLEDDSSKVVLVFGQMNEPPGARSRVVLTGLTIAEYFRDVDGQDVLLFIDNIFRFTQAGSEV 362
            .||:||.: |||.|||||||||||||:||.||||||||||||.:|||||||||||||||||||||
Yeast   238 GVINLEGE-SKVALVFGQMNEPPGARARVALTGLTIAEYFRDEEGQDVLLFIDNIFRFTQAGSEV 301

  Fly   363 SALLGRIPSAVGYQPTLGTDMGTMQERITSTRNGSITSVQAVYVPADDLSDPAPAATFSHLDATT 427
            |||||||||||||||||.||||.:|||||:|:.||:|||||||||||||:|||||.||:||||||
Yeast   302 SALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVTSVQAVYVPADDLTDPAPATTFAHLDATT 366

  Fly   428 VLSRPIAELGIYPAVDPLDSSSRILDPDVVGEEHYNVARAVQKTLQAYKSLQDIIAILGMDELSE 492
            ||||.|:|||||||||||||.||:||..|||:|||:||..||:|||.||||||||||||||||||
Yeast   367 VLSRGISELGIYPAVDPLDSKSRLLDAAVVGQEHYDVASKVQETLQTYKSLQDIIAILGMDELSE 431

  Fly   493 EDKLTVARARKMQRFLSQPFQVAEIFTGHPGKLVPVEKCVEGFKRLLNGEYDDIPEIAFYMVGDA 557
            :|||||.||||:||||||||.|||:|||.|||||.::..|..||.:|.|:||:|||.||||||..
Yeast   432 QDKLTVERARKIQRFLSQPFAVAEVFTGIPGKLVRLKDTVASFKAVLEGKYDNIPEHAFYMVGGI 496

  Fly   558 EEVLAKATQLAA 569
            |:|:|||.:|||
Yeast   497 EDVVAKAEKLAA 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 337/465 (72%)
ATP-synt_ab_N 106..173 CDD:280947 39/68 (57%)
F1-ATPase_beta 175..454 CDD:238553 215/279 (77%)
ATP-synt_ab_C 462..571 CDD:278722 78/109 (72%)
ATP2NP_012655.3 PRK09280 41..500 CDD:236447 333/458 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C301392852
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S51
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127099
Panther 1 1.100 O PTHR15184
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.650

Return to query results.
Submit another query.