DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and AT5G08690

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_568204.1 Gene:AT5G08690 AraportID:AT5G08690 Length:556 Species:Arabidopsis thaliana

Alignment Length:492 Identity:342/493 (69%)
Similarity:407/493 (83%) Gaps:11/493 (2%)


  Fly    81 AEDECEEKKSDGGGKKLESKGRKGVIHAVIGPVIDVYFEEE--VPEVLNALQVQDAPIANLVLEV 143
            |:|| .:|..|.||     ||..|.:..|||.::||.||::  :|.::.:|:|||.| ..|||||
plant    67 AKDE-GKKTYDYGG-----KGAIGRVCQVIGAIVDVRFEDQEGLPPIMTSLEVQDHP-TRLVLEV 124

  Fly   144 FHHLGNNIVRCVAMDSTEGLRRGQPVLDTGYPIRVAVGKAVLGRILNVVGDPIDDRGEVKSDFYS 208
            .||||.|:||.:|||.||||.||:.||:||.||.|.||:|.||||:||:|:|||:|||:|::.|.
plant   125 SHHLGQNVVRTIAMDGTEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPIDERGEIKTEHYL 189

  Fly   209 FIHNEAPELTDLSVKPEILVTGIKVIDLLAPYVKGGKIGLFGGAGVGKTVLIMELINNIAKSHGG 273
            .||.:||.|.||:...|||.|||||:||||||.:||||||||||||||||||||||||:||:|||
plant   190 PIHRDAPALVDLATGQEILATGIKVVDLLAPYQRGGKIGLFGGAGVGKTVLIMELINNVAKAHGG 254

  Fly   274 YSVFVGAGERTREGNDLYHEMIESKVISL--EDDSSKVVLVFGQMNEPPGARSRVVLTGLTIAEY 336
            :|||.|.|||||||||||.|||||.||.|  :...||..||:||||||||||:||.|||||:|||
plant   255 FSVFAGVGERTREGNDLYREMIESGVIKLGEKQSESKCALVYGQMNEPPGARARVGLTGLTVAEY 319

  Fly   337 FRDVDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLGTDMGTMQERITSTRNGSITSV 401
            |||.:|||||||||||||||||.||||||||||||||||||||.:|:|.:|||||:|:.||||||
plant   320 FRDAEGQDVLLFIDNIFRFTQANSEVSALLGRIPSAVGYQPTLASDLGALQERITTTKKGSITSV 384

  Fly   402 QAVYVPADDLSDPAPAATFSHLDATTVLSRPIAELGIYPAVDPLDSSSRILDPDVVGEEHYNVAR 466
            ||:|||||||:|||||.||:||||||||||.|:|||||||||||||:||:|.|.::||||||.||
plant   385 QAIYVPADDLTDPAPATTFAHLDATTVLSRQISELGIYPAVDPLDSTSRMLSPHILGEEHYNTAR 449

  Fly   467 AVQKTLQAYKSLQDIIAILGMDELSEEDKLTVARARKMQRFLSQPFQVAEIFTGHPGKLVPVEKC 531
            .|||.||.||:|||||||||||||||:||||||||||:||||||||.|||||||.|||.|.:::.
plant   450 GVQKVLQNYKNLQDIIAILGMDELSEDDKLTVARARKIQRFLSQPFHVAEIFTGAPGKYVDLKEN 514

  Fly   532 VEGFKRLLNGEYDDIPEIAFYMVGDAEEVLAKATQLA 568
            :..|:.||:|:|||:.|.:|||||..:||:|||.::|
plant   515 INSFQGLLDGKYDDLSEQSFYMVGGIDEVVAKAEKIA 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 332/469 (71%)
ATP-synt_ab_N 106..173 CDD:280947 37/69 (54%)
F1-ATPase_beta 175..454 CDD:238553 215/281 (77%)
ATP-synt_ab_C 462..571 CDD:278722 74/108 (69%)
AT5G08690NP_568204.1 Synthase_beta 1..47 CDD:288303
PRK09280 81..551 CDD:236447 333/471 (71%)
ATP-synt_ab_N 86..154 CDD:280947 37/69 (54%)
F1-ATPase_beta 156..437 CDD:238553 215/281 (77%)
ATP-synt_ab_C 445..553 CDD:278722 74/108 (69%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D495235at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127099
Panther 1 1.100 O PTHR15184
Phylome 1 0.910 0.667 Consistency score
54.920

Return to query results.
Submit another query.