DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and jarid2b

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001189388.1 Gene:jarid2b ZFINID:ZDB-GENE-060503-246 Length:1319 Species:Danio rerio

Alignment Length:191 Identity:41/192 (21%)
Similarity:61/192 (32%) Gaps:70/192 (36%)


  Fly   464 VARAVQKTLQAYKSLQDIIAILGMDELSEEDKLTVARARKMQRFLSQPFQVAEIFTGHPGKLVPV 528
            |.|.|::.|:..|...|.:.:||....|||.| |..:..::::...||              .|:
Zfish   420 VDRPVRQGLRNSKRRSDAMTLLGAVTESEETK-TKQQTTEVKKAKVQP--------------SPL 469

  Fly   529 E----KCVEGFKRLLNGEYDDIPEIAFYMVGDAEEVLAKATQLAAS---MSGDAPPAKAEAKKDE 586
            |    |.:..||.         |.|.        .:....|::|||   .:|.|||....|.  .
Zfish   470 ETRSKKALNQFKS---------PNIV--------TIAHSITEMAASPIQKTGPAPPPSPPAA--P 515

  Fly   587 KKDTKPEEGKKEEPPKGEDKKEEA-----------------------------KDDKPKEP 618
            ...:.|:.....||.:...|:..|                             |..||.||
Zfish   516 ASPSMPQNPAIPEPARQRPKRASAGKLMFIRKAQQRAQTNPTLNRTTSTTSASKSFKPAEP 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 23/108 (21%)
ATP-synt_ab_N 106..173 CDD:280947
F1-ATPase_beta 175..454 CDD:238553
ATP-synt_ab_C 462..571 CDD:278722 26/114 (23%)
jarid2bNP_001189388.1 Nuclear localization signal. {ECO:0000250} 96..102
JmjN 607..647 CDD:128818
ARID 673..775 CDD:198082
GSGFP motif 944..948
JmjC 986..1101 CDD:202224
zf-C5HC2 1209..1262 CDD:280996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.