DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and kdm6ba

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_005172296.1 Gene:kdm6ba ZFINID:ZDB-GENE-091005-1 Length:1996 Species:Danio rerio

Alignment Length:568 Identity:108/569 (19%)
Similarity:180/569 (32%) Gaps:184/569 (32%)


  Fly    95 KKLESKGRKGV---IHAVIGPVIDVYFEEEVPEVL-----NALQVQDAPIANLVLEVFHHLGNNI 151
            |::.|.|.:|:   ..:..|......||||..|:|     |.:::.|..|..             
Zfish   913 KQIPSAGLQGLGSNASSCSGDSDGAQFEEETSELLPDGLANIMKMLDESIKK------------- 964

  Fly   152 VRCVAMDSTEGLRRGQPVLDTGYPIRVAVGKAVL---GRILNVVGDPIDDRGEVKSDFYSFIHNE 213
                ..:...|.:..|.|.:..:...||..|:.|   ..:..:...|.:       |:....|..
Zfish   965 ----EEELYSGQKGEQAVSELQFSTNVAPVKSYLCAPDLVPALKQSPAE-------DYQPDGHAS 1018

  Fly   214 APEL-------------TDLSVKPEILVTGIKVIDLLAPYVKGGKIGLFGGAGVGKTVLIMELIN 265
            .|.|             :.|..:.|:|.:.:|||...|.                         :
Zfish  1019 PPVLSRQGSLASPCSRTSSLEEEEEVLASSLKVIPKSAN-------------------------S 1058

  Fly   266 NIAKSHGGYSVFVGAGERTREGNDLY--HEMIESKVISLEDDSSKVVLVFGQMNEPPGA----RS 324
            |...|..|.....|...|..:...||  .|:::|:   .|||..:|    .:.:|.|..    |.
Zfish  1059 NSVLSQDGSLATTGTNYRHSDLAKLYGISEVVKSE---CEDDEDEV----DREDETPSCSPPQRP 1116

  Fly   325 RVVLTGLTIAEYFRDVDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSA----VGYQP--TLGTDM 383
            .:..||  :...|::      |..:....::|..|..    .||.|.:    |.|..  :||.|:
Zfish  1117 HLHQTG--VNSMFKN------LASVLESQKYTYRGGP----FGRPPRSAFVGVKYSSSLSLGPDI 1169

  Fly   384 GTMQERITSTRNGSITSVQAVYVPADDLSDPAPAATFSHLDATTVLSRPIAELGIYPAVDPLDSS 448
             ..|::.||..:||.:.        ...|.|...:..|:...|..||....|       ......
Zfish  1170 -CRQQQSTSPTSGSASH--------PGFSSPTQTSAISNSGQTCPLSPTSCE-------SESKRG 1218

  Fly   449 SRILDPDVVGEEHYNVARAVQKTLQAYKSLQDIIAILGMDE--LSEEDKLTVARARKMQRFLSQP 511
            .:|...|::|.:                           ||  :|||.|:.|...........:|
Zfish  1219 DKISPSDLLGND---------------------------DEKDISEEPKVKVDSGNMKDLLERRP 1256

  Fly   512 --FQVAEIFTGHPGKLVPVEKCVEGFKRLLNGEYDDIPEIAFYMVGDAEEVLAKATQLAASMSGD 574
              ..::|......|:.:.|.|.:..||                     :...|:|.::.      
Zfish  1257 KLTTISESSLAELGQSLEVNKHIIPFK---------------------DHSKAEAREIC------ 1294

  Fly   575 APPAKAEAKKDEKKDTKPEEGKKEEPPKGEDKKEEAKDDKPKEPEKKD 622
            .|..:.|..:|.:::.|.:.....:  |.|||||.    |.|..|:.|
Zfish  1295 KPVEEKERHRDRERERKHKHSSSSK--KHEDKKER----KKKHRERHD 1336

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 91/505 (18%)
ATP-synt_ab_N 106..173 CDD:280947 13/72 (18%)
F1-ATPase_beta 175..454 CDD:238553 59/307 (19%)
ATP-synt_ab_C 462..571 CDD:278722 16/113 (14%)
kdm6baXP_005172296.1 Atrophin-1 <128..507 CDD:331285
Herpes_BLLF1 478..>693 CDD:330317
JmjC 1696..1760 CDD:214721
JmjC 1730..1838 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.