DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and Vha68-1

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001260426.1 Gene:Vha68-1 FlyBaseID:FBgn0265262 Length:614 Species:Drosophila melanogaster

Alignment Length:650 Identity:155/650 (24%)
Similarity:247/650 (38%) Gaps:194/650 (30%)


  Fly    72 AELVKKKDEAEDECEEKKSDGGGKKLESKGRKGVIHAVIGPVIDVYFEEEVPEVLNALQVQDAPI 136
            :.|.|.|||                 |.:...|.::||.|||:            .|..:..:.:
  Fly     2 SNLRKFKDE-----------------ERESEYGRVYAVSGPVV------------TAEAMSGSAM 37

  Fly   137 ANLVLEVFHHLGNNIVR-------CVAMDSTEGLRRGQPVLDTGYPIRVAVGKAVLGRILNVVGD 194
            ..||...::.|...|:|       ....:.|.|:..|.|||.||.|:.|.:|..::|.|.:.:..
  Fly    38 YELVRVGYYELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQR 102

  Fly   195 PIDDRGEVKS-----------------------------------DFYSFIHNE----------- 213
            |:.|.|.:.:                                   |.|..:|..           
  Fly   103 PLRDIGVMTNSIYIPKGVNTTALSRSEMWEFNPLNVRVGSHITGGDLYGVVHENTLVKQRMIVAP 167

  Fly   214 ---------AP----ELTDLSVKPEI------------------------------LVTGIKVID 235
                     ||    .|.|:.::.|.                              |.||.:|:|
  Fly   168 RAKGTVRYIAPAGNYNLEDIVLETEFDGEITKHTMLQVWPVRQPRPVTEKLPANHPLFTGQRVLD 232

  Fly   236 LLAPYVKGGKIGLFGGAGVGKTVLIMELINNIAKSHGGYSVFVGAGERTREGNDLYHEMIESKVI 300
            .|.|.|:||...:.|..|.||||:...|..   .|:....::||.|||   ||::...:.:...:
  Fly   233 SLFPCVQGGTTAIPGAFGCGKTVISQALSK---YSNSDVIIYVGCGER---GNEMSEVLRDFPEL 291

  Fly   301 SLEDDS------SKVVLVFGQMNEPPGARSRVVLTGLTIAEYFRDVDGQDVLLFIDNIFRFTQAG 359
            :.|.|.      .:..||....|.|..||...:.||:|::|||||: |.:|.:..|:..|:.:|.
  Fly   292 TCEIDGVTESIMKRTALVANTSNMPVAAREASIYTGITLSEYFRDM-GYNVAMMADSTSRWAEAL 355

  Fly   360 SEVSALLGRIPSAVGYQPTLGTDMGTMQERI-------TSTRNGSITSVQAVYVPADDLSDPAPA 417
            .|:|..|..:|:..||...||..:.|..||.       ...|.||::.|.||..|..|.|||..:
  Fly   356 REISGRLAEMPADSGYPAYLGARLATFYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDPVTS 420

  Fly   418 ATFSHLDATTVLSRPIAELGIYPAVDPLDSSS---RILDPDVVGEEHYN--------VARAVQKT 471
            ||...:.....|.:.:|:...:|:::.|.|.|   |.||      |:|:        :...|::.
  Fly   421 ATLGIVQVFWGLDKKLAQRKHFPSINWLISYSKYMRALD------EYYDKNYPEFVPLRTKVKEI 479

  Fly   472 LQAYKSLQDIIAILGMDELSEEDKLTVARARKMQ-RFLSQ----PFQVAEIFTGHPGKLVPVEKC 531
            ||..:.|.:|:.::|...|:|.||:|:..|:.:: .||.|    |:.          ::.|..|.
  Fly   480 LQEEEDLSEIVQLVGKASLAETDKVTLEVAKLLKDDFLQQNSYSPYD----------RVCPFYKT 534

  Fly   532 VEGFKRLLNGEYDDIPEIAFYMVG-DAEEVLAKA------TQLAASMSGDAPPAKAEAKKDEKKD 589
            |...:.::          |||... .|.|..|::      ..:..||.|......:...||..||
  Fly   535 VGMLRNIM----------AFYETARHAVESTAQSDNKITWNTIRESMGGIMYQLSSMKFKDPVKD 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 142/597 (24%)
ATP-synt_ab_N 106..173 CDD:280947 18/74 (24%)
F1-ATPase_beta 175..454 CDD:238553 95/384 (25%)
ATP-synt_ab_C 462..571 CDD:278722 27/129 (21%)
Vha68-1NP_001260426.1 V-ATPase_V1_A 15..606 CDD:273411 149/620 (24%)
ATP-synt_ab_N 19..81 CDD:280947 18/74 (24%)
V_A-ATPase_A 83..454 CDD:238554 92/378 (24%)
ATP-synt_ab_C 472..614 CDD:278722 32/138 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C83121448
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.