DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and Vha68-2

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001246015.1 Gene:Vha68-2 FlyBaseID:FBgn0263598 Length:614 Species:Drosophila melanogaster

Alignment Length:609 Identity:142/610 (23%)
Similarity:238/610 (39%) Gaps:149/610 (24%)


  Fly    98 ESKGRKGVIHAVIGPVIDVYFEEEVPEVLNALQVQDAPIANLVLEVFHHLGNNIVR-------CV 155
            |.:.:.|.:.||.|||:            .|..:..:.:..||...::.|...|:|       ..
  Fly    11 ERESKYGRVFAVSGPVV------------TAEAMSGSAMYELVRVGYYELVGEIIRLEGDMATIQ 63

  Fly   156 AMDSTEGLRRGQPVLDTGYPIRVAVGKAVLGRILNVVGDPIDDRGEVK----------------- 203
            ..:.|.|:..|.|||.||.|:.|.:|..::|.|.:.:..|:.|..|:.                 
  Fly    64 VYEETSGVTVGDPVLRTGKPLSVELGPGIMGSIFDGIQRPLKDINELTESIYIPKGVNVPSLSRV 128

  Fly   204 ------------------SDFYSFIHNE--------------------AP----ELTDLSVKPEI 226
                              .|.|..:|..                    ||    ::.|:.::.|.
  Fly   129 ASWEFNPLNVKVGSHITGGDLYGLVHENTLVKHKMIVNPRAKGTVRYIAPSGNYKVDDVVLETEF 193

  Fly   227 ------------------------------LVTGIKVIDLLAPYVKGGKIGLFGGAGVGKTVLIM 261
                                          |:||.:|:|.|.|.|:||...:.|..|.||||:..
  Fly   194 DGEITKHTMLQVWPVRQPRPVTEKLPANHPLLTGQRVLDSLFPCVQGGTTAIPGAFGCGKTVISQ 258

  Fly   262 ELINNIAKSHGGYSVFVGAGERTREGNDLYHEMIESKVISLEDDS------SKVVLVFGQMNEPP 320
            .|..   .|:....::||.|||   ||::...:.:...:|:|.|.      .:..||....|.|.
  Fly   259 ALSK---YSNSDVIIYVGCGER---GNEMSEVLRDFPELSVEIDGVTESIMKRTALVANTSNMPV 317

  Fly   321 GARSRVVLTGLTIAEYFRDVDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLGTDMGT 385
            .||...:.||:|::|||||: |.:|.:..|:..|:.:|..|:|..|..:|:..||...||..:.:
  Fly   318 AAREASIYTGITLSEYFRDM-GYNVSMMADSTSRWAEALREISGRLAEMPADSGYPAYLGARLAS 381

  Fly   386 MQERI-------TSTRNGSITSVQAVYVPADDLSDPAPAATFSHLDATTVLSRPIAELGIYPAVD 443
            ..||.       ...|.||::.|.||..|..|.|||..:||...:.....|.:.:|:...:|:::
  Fly   382 FYERAGRVKCLGNPEREGSVSIVGAVSPPGGDFSDPVTSATLGIVQVFWGLDKKLAQRKHFPSIN 446

  Fly   444 PLDSSS---RILDP--DVVGEEHYNVARAVQKTLQAYKSLQDIIAILGMDELSEEDKLTVARARK 503
            .|.|.|   |.||.  |....|...:...|::.||..:.|.:|:.::|...|:|.||:|:    :
  Fly   447 WLISYSKYMRALDDFYDKNFPEFVPLRTKVKEILQEEEDLSEIVQLVGKASLAETDKITL----E 507

  Fly   504 MQRFLSQPFQVAEIFTGHPGKLVPVEKCVEGFKRLLNGEYDDIPEIAFYMVGDAE---------E 559
            :.:.|...|.....::.: .:..|..|.|...:.::  ::.|:...:......:|         |
  Fly   508 VAKLLKDDFLQQNSYSSY-DRFCPFYKTVGMLRNII--DFYDMARHSVESTAQSENKITWNVIRE 569

  Fly   560 VLAKATQLAASMSGDAPPAKAEAK 583
            .:.......:||....|....|||
  Fly   570 AMGNIMYQLSSMKFKDPVKDGEAK 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 135/588 (23%)
ATP-synt_ab_N 106..173 CDD:280947 18/74 (24%)
F1-ATPase_beta 175..454 CDD:238553 94/384 (24%)
ATP-synt_ab_C 462..571 CDD:278722 20/118 (17%)
Vha68-2NP_001246015.1 V-ATPase_V1_A 16..606 CDD:273411 141/605 (23%)
ATP-synt_ab_N 19..81 CDD:280947 18/74 (24%)
V_A-ATPase_A 83..454 CDD:238554 91/378 (24%)
ATP-synt_ab_C 472..614 CDD:278722 25/130 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C83121478
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.