DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and kdm5bb

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_005167081.1 Gene:kdm5bb ZFINID:ZDB-GENE-030424-1 Length:1522 Species:Danio rerio

Alignment Length:306 Identity:64/307 (21%)
Similarity:100/307 (33%) Gaps:115/307 (37%)


  Fly   404 VYVPA-DDLSDPAPAATFSHLDATTVLSRPIAE-----------------------LGIYPAV-- 442
            |:.|: ::..||     |:.::..    |||||                       |...|.:  
Zfish    17 VFEPSWEEFKDP-----FAFINKI----RPIAEKTGICKVRPPPDWQPPFACDVDRLHFTPRIQR 72

  Fly   443 -DPLDSSSRI----LDP-----DVVGEEHYNVARAVQKTLQAYKSLQDIIAILGMDELSEEDKLT 497
             :.|::.:|:    ||.     |:.|.. ..:....:|.|..|: |..::|..|..:|       
Zfish    73 LNELEAQTRVKLNFLDQIAKFWDLQGCT-LKIPHVERKILDLYQ-LNKLVADEGGFDL------- 128

  Fly   498 VARARKMQRFLSQPFQVAEIFTGHPGKLV------PVEKCVEGFKRLLNGEYDDIPEIAFYMVGD 556
            |.|.|:..:       :|......|||.|      ..|:.:..:....:|.....||.|..:.|.
Zfish   129 VCRERRWTK-------IAMTMGFAPGKAVGSHLRAHYERILYPYNLFQSGTNLLAPEFAVKLTGF 186

  Fly   557 AE-EVLAKATQLAASMSGD------------------------APPAKAEAKKDEKKDTKPEEG- 595
            .| .||.:..|.......|                        ||..:|:..|.|....|.||| 
Zfish   187 GEPPVLEECLQKPGDEVNDIDKEYKPHDLLQRQNVPLQPSNTSAPARRAKRMKTESGCIKSEEGE 251

  Fly   596 ---------------------KKEEPPKGEDKKEEAKDDKPKEPEK 620
                                 |||.|.:.:::..|.|:..| ||||
Zfish   252 GVENKPNLRRRMGSFVVKTEQKKEIPIQVKEEPVEIKELNP-EPEK 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 43/207 (21%)
ATP-synt_ab_N 106..173 CDD:280947
F1-ATPase_beta 175..454 CDD:238553 16/81 (20%)
ATP-synt_ab_C 462..571 CDD:278722 25/116 (22%)
kdm5bbXP_005167081.1 JmjN 14..55 CDD:128818 10/47 (21%)
BRIGHT 81..171 CDD:128777 21/106 (20%)
PHD1_KDM5B 316..361 CDD:277076
JmjC 491..607 CDD:202224
zf-C5HC2 697..749 CDD:280996
PLU-1 762..1096 CDD:285609
PHD2_KDM5B 1189..1232 CDD:277080
PHD3_KDM5B 1465..1513 CDD:277157
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.