DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and Jarid2

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_648324.1 Gene:Jarid2 FlyBaseID:FBgn0036004 Length:2351 Species:Drosophila melanogaster

Alignment Length:686 Identity:130/687 (19%)
Similarity:196/687 (29%) Gaps:287/687 (42%)


  Fly     9 ATACARIGLKMGPGTGGYRGN-----YLGNPVVFP------------RYLHASLSLWDDKDKKKS 56
            :.|.|..|...||.|.|...|     .|.|....|            |.|.|.|   |..::.||
  Fly    74 SAAAAAAGSGSGPSTSGADSNQPPIEILPNKCPKPQDFLTFLCFRGTRALPAHL---DFLNQGKS 135

  Fly    57 GDECEPEPQEVCKTDAELVKKKDEAEDECEEKKSDGGGKKLESKGRKGVIHA--VIGPVIDVYFE 119
            .|      .|...|.|   ...:.|......:.|..|.||...:..||....  |:.|       
  Fly   136 KD------SEASSTGA---NNNNNARKPNNSRASLAGNKKKRGRPAKGATKKVDVVAP------- 184

  Fly   120 EEVPEVLNALQVQDAPIANLVLEVFHHLGNNIVRCVAMDSTEGLRRGQPVLDTGYPIRVAVGKAV 184
              :|:........:.|.::         .||::...|           |.:.:..|..|..|   
  Fly   185 --IPDPTEKPSTAEKPASD---------KNNLIAAEA-----------PKIPSRNPTPVLPG--- 224

  Fly   185 LGRILNVVGDPIDDRGEVKSDFYSFIHNEAPELTDLSVKPEILVTGIKVIDLLAPYVKGGKIGLF 249
                      .:..|.||.:|                                     |.:.|..
  Fly   225 ----------AVRKRAEVVTD-------------------------------------GNRRGAR 242

  Fly   250 G-GAGVGKTVLIMELINNIAKSHGGYSVFVGAGERTREGNDLYHEMIESKVISLEDDSSKVVLVF 313
            | |||:               ||...:....:.:..|..|....:  |||.: ::||:|:     
  Fly   243 GRGAGI---------------SHDKTTPAALSKDNKRRSNRASTK--ESKPV-IDDDNSE----- 284

  Fly   314 GQMNEPPGARSRVVLTGLTIAEYFRDVDGQDVLLFIDNIFRFTQA----GSEVSALLGRIPSAVG 374
                                     |:|.|:.....|..|....|    |.||.|     .|.|.
  Fly   285 -------------------------DLDEQEADDDEDEFFSAHDATSRNGEEVKA-----DSPVK 319

  Fly   375 YQPTLGTDMGTMQERITSTRNGSITSVQAVYVPADD----LSDPAPAATFSHLDATTVLSRPIAE 435
            .:|               |:.|..::.:....||.:    |.|.||.......::...:..|   
  Fly   320 AEP---------------TKRGRPSAAKKAVEPAPEGQTVLKDKAPVKRVRQRESPIFIPSP--- 366

  Fly   436 LGIYPAVDPLDSSSRIL---------------------DP--DVVGEEHYNVARAVQKTLQAYKS 477
                      :||.|:.                     ||  |...::........:|..:..|.
  Fly   367 ----------ESSGRMTRQRAFFEPVKVPPHKEEPGAHDPPKDEPKKQPETPPSKTEKEQEPTKQ 421

  Fly   478 LQD--------IIAILGMDELSEEDKLTVARARKMQRFLSQPFQVAEIFTGHPGKLVPVEKCVEG 534
            :::        |.|.....:|...|.|..|.|:.                               
  Fly   422 IKEAKEKTNSSIYAKEAKQQLENGDSLHGAVAKG------------------------------- 455

  Fly   535 FKRLLNGEYDDIPEIAFYMVGDAEEVLAKATQLAASMSGDAP---------PA----KAEAKK-D 585
             |:.||         .|....|.|:.|||:.:|.....|.:|         ||    ||.||| |
  Fly   456 -KKSLN---------VFDFSSDDEQPLAKSIKLKKGAKGASPKKGGAAPIAPAARNRKAAAKKLD 510

  Fly   586 EKKDTKPEEGKKEEPPKGEDKKEEAKD-DKPKEPEK 620
            ::|:.:.|:.:::|.....||.:|.|| :|.||.||
  Fly   511 KEKEIEKEKQREKEEEIERDKAKEKKDKEKEKEKEK 546

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 80/507 (16%)
ATP-synt_ab_N 106..173 CDD:280947 8/69 (12%)
F1-ATPase_beta 175..454 CDD:238553 49/309 (16%)
ATP-synt_ab_C 462..571 CDD:278722 19/117 (16%)
Jarid2NP_648324.1 JmjN 1740..1781 CDD:128818
ARID 1812..1893 CDD:279697
JmjC 2066..2181 CDD:202224
zf-C5HC2 2281..2334 CDD:280996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.