DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and JARID2

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:XP_011512881.1 Gene:JARID2 HGNCID:6196 Length:1309 Species:Homo sapiens

Alignment Length:400 Identity:91/400 (23%)
Similarity:147/400 (37%) Gaps:101/400 (25%)


  Fly   271 HGGYSVFVGAGERTREGNDLY-HEMIES----------KVISLEDDSSKVVLVFGQMNEPPGARS 324
            |.|: ||.|:...|||...:. |:..|:          :..|..:.:|        .|.|..|.|
Human   283 HNGH-VFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQAS--------ANHPAAAPS 338

  Fly   325 R-VVLTGLTIAEYFRDV--DGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLGTDMGTM 386
            . ....||....:...:  ..||:...:..:...|:    :|:|...:.||...:....:...|:
Human   339 TGSSAKGLAATHHHPPLHRSAQDLRKQVSKVNGVTR----MSSLGAGVTSAKKMREVRPSPSKTV 399

  Fly   387 QERITSTRNGSITSVQAVYVPADDL--SDPAPAATFSHL--------DATT---VLSRPIAELGI 438
            :...|.|: |::|..:|......|.  :...|::..:|.        :|.|   |||...|....
Human   400 KYTATVTK-GAVTYTKAKRELVKDTKPNHHKPSSAVNHTISGKTESSNAKTRKQVLSLGGASKST 463

  Fly   439 YPAVDPLDSSSRILDP-----DVVGEEHYNVARAVQKTLQAYKSLQDIIAILGMDELSEEDKLTV 498
            .|||:.|..|.| |:|     :|.|       |.:::.||..:.|::             .|..:
Human   464 GPAVNGLKVSGR-LNPKSCTKEVGG-------RQLREGLQLREGLRN-------------SKRRL 507

  Fly   499 ARARKMQRFLSQPFQV------AEIFTGHPGKLVPVEKCVEGFKRLLNGEY-DDIPEIAFYMVGD 556
            ..|.:.::..|.|.::      ||    .|||..|.|      :.||||.. .::||.:.     
Human   508 EEAHQAEKPQSPPKKMKGAAGPAE----GPGKKAPAE------RGLLNGHVKKEVPERSL----- 557

  Fly   557 AEEVLAKATQLAASMSGDAPPAKAEAKKDEKKDT-------KPEEGKKEEPPKGEDKKE-EAKDD 613
             |....|......|..|.....||::...|.:.|       ||::..|.|  ||..|.. .|.|:
Human   558 -ERNRPKRATAGKSTPGRQAHGKADSASCENRSTSQPESVHKPQDSGKAE--KGGGKAGWAAMDE 619

  Fly   614 KP-KEPEKKD 622
            .| ..|..|:
Human   620 IPVLRPSAKE 629

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 73/336 (22%)
ATP-synt_ab_N 106..173 CDD:280947
F1-ATPase_beta 175..454 CDD:238553 47/210 (22%)
ATP-synt_ab_C 462..571 CDD:278722 24/116 (21%)
JARID2XP_011512881.1 JmjN 619..660 CDD:128818 3/11 (27%)
BRIGHT 686..777 CDD:128777
JmjC 979..1094 CDD:202224
zf-C5HC2 1202..1255 CDD:280996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.