DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and Kdm5a

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001264106.1 Gene:Kdm5a RGDID:1305429 Length:1690 Species:Rattus norvegicus

Alignment Length:302 Identity:66/303 (22%)
Similarity:103/303 (34%) Gaps:85/303 (28%)


  Fly   357 QAGSE-----VSALLGRIPSAVGYQPTLGTDMGTMQERITSTRNGSITSVQAVYVPADDLSDPAP 416
            ||..|     :||.|.:..:    .|.|...:.:.|:   |..|..::||.:           :|
  Rat  1286 QAAREKTEKIISAELQKAAA----NPDLQGHLPSFQQ---SAFNRVVSSVSS-----------SP 1332

  Fly   417 AATFSHLDATTVLSRPIAELGIYPAVDPLD-SSSRILDPDVVGEEHYNVARAVQKT--------- 471
            .....:.|..|.....|.|...|...|... .||..|:|::..:|...:......|         
  Rat  1333 HQAMDYDDEETDSDEDIRETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFC 1397

  Fly   472 -LQAYKSLQDIIAILGMDELSEEDKLTVARARKMQRFLSQPFQVAEIFTGHPGKLVPVEKCVEGF 535
             ..||.|     |.....:.|...:....::..:.|.|..|  |.|:   .||....:|:.:   
  Rat  1398 AEHAYSS-----ASKSCSQGSSTPRKQPRKSPLVPRSLEPP--VLEL---SPGAKAQLEELM--- 1449

  Fly   536 KRLLNGEYDDIPEIAFYMVGDAEEVLAKATQ-LAASMSGDAPPAK---AEAKKDEKKDTKP---- 592
                             ||||..||....|| :...:....||::   ....:|:..:.||    
  Rat  1450 -----------------MVGDLLEVSLDETQHIWRILQATHPPSEDRFLHIMEDDSVEEKPLKMK 1497

  Fly   593 -----EEGKKEEPPK-----GEDK---KEEAKDDKPKEPEKK 621
                 |:.:|.:..|     ||.|   ||..|.||||:.:.|
  Rat  1498 GKDSSEKKRKRKLEKVEQFFGEGKQKTKELKKIDKPKKKKLK 1539

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 47/228 (21%)
ATP-synt_ab_N 106..173 CDD:280947
F1-ATPase_beta 175..454 CDD:238553 23/103 (22%)
ATP-synt_ab_C 462..571 CDD:278722 22/120 (18%)
Kdm5aNP_001264106.1 JmjN 18..59 CDD:128818
ARID 85..170 CDD:198082
PHD1_KDM5A 295..343 CDD:277075
JmjC 470..586 CDD:202224
zf-C5HC2 676..728 CDD:280996
PLU-1 741..1070 CDD:285609
PHD2_KDM5A 1163..1215 CDD:277079
PHD3_KDM5A 1608..1659 CDD:277156
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.