DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and Kdm5a

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_666109.2 Gene:Kdm5a MGIID:2136980 Length:1690 Species:Mus musculus

Alignment Length:425 Identity:89/426 (21%)
Similarity:144/426 (34%) Gaps:148/426 (35%)


  Fly   216 ELTDLSVKPEILVT--GIKVIDLLAPYVK-GGKIGLFGGAGVGKTVLIMELINNIAKSHGGYSVF 277
            ::.||....:|:.:  |.:::.....:.| |.::|...|.|.|          ::.|||  |...
Mouse   113 KILDLYALSKIVASKGGFEIVTKEKKWSKVGSRLGYLPGKGTG----------SLLKSH--YERI 165

  Fly   278 VGAGERTREGNDL---------YHEMIESKVISLEDDSSKVVLVFGQMNEPPGARSRVVLTGLTI 333
            :...|..:.|..|         ..|.:|::|:|.:...|.....  :||.|| .|:|.|.:....
Mouse   166 LYPYELFQSGVSLMGVQMPDLDLKEKVEAEVLSTDIQPSPERGT--RMNIPP-KRTRRVKSQSDS 227

  Fly   334 AEYFRDVDGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQP-----------TLGTDMGTMQ 387
            .|..|:.:.:.:.:|        .||.:|..|      |||.:.           |..:|...||
Mouse   228 GEVNRNTELKKLQIF--------GAGPKVVGL------AVGAKDKEDEVTRRRKVTNRSDAFNMQ 278

  Fly   388 ERITSTRNGSITSVQAV--YV--------------PADDLSDPAPAATFSHLDATTVLSRPIAEL 436
            .|   .|.|:: ||..|  ||              ..|...|.      .|   |..|..|:   
Mouse   279 MR---QRKGTL-SVNFVDLYVCMFCGRGNNEDKLLLCDGCDDS------YH---TFCLLPPL--- 327

  Fly   437 GIYPAVDPLDSSSRILDPDVVGE------EHYNVARAVQK-TLQAYKSLQDIIAILGMDELSEED 494
               |.|...|...    |..|.|      |.:...:||:: |||::..:.|              
Mouse   328 ---PDVPKGDWRC----PKCVAEECNKPREAFGFEQAVREYTLQSFGEMAD-------------- 371

  Fly   495 KLTVARARKMQRFLSQPFQVAEIFTGHPGKLVPVEKCVEGFKRLLNGEYDDIPEIAFYMVGDAEE 559
                       .|.|..|.:       |..:||.|...:.|.||::...:|:             
Mouse   372 -----------NFKSDYFNM-------PVHMVPTELVEKEFWRLVSSIEEDV------------- 405

  Fly   560 VLAKATQLAASMSGDAPPAKAEAKKDEKKDTKPEE 594
            ::.....:::...|...|     |||.::...|||
Mouse   406 IVEYGADISSKDFGSGFP-----KKDGQRKMLPEE 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 81/398 (20%)
ATP-synt_ab_N 106..173 CDD:280947
F1-ATPase_beta 175..454 CDD:238553 60/277 (22%)
ATP-synt_ab_C 462..571 CDD:278722 17/110 (15%)
Kdm5aNP_666109.2 JmjN 18..59 CDD:128818
ARID 85..170 CDD:198082 14/69 (20%)
PHD1_KDM5A 295..343 CDD:277075 12/67 (18%)
GSGFP motif. {ECO:0000269|PubMed:20064375} 419..423 1/4 (25%)
JmjC 470..586 CDD:202224
zf-C5HC2 676..728 CDD:280996
PLU-1 741..1070 CDD:285609
PHD2_KDM5A 1163..1215 CDD:277079
PHD3_KDM5A 1608..1659 CDD:277156
Interaction with LMO2. {ECO:0000250|UniProtKB:P29375} 1622..1690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.