DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and Kdm5d

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_035549.1 Gene:Kdm5d MGIID:99780 Length:1548 Species:Mus musculus

Alignment Length:176 Identity:43/177 (24%)
Similarity:60/177 (34%) Gaps:66/177 (37%)


  Fly   486 GMDELSEEDKLTVARARKMQRFLSQPFQVAEIFTGHPGKLVPVEKCVEGFKRL-------LNGEY 543
            |.|.|.||::|.:...|         .:.:|       |:||.|...:|.|.|       |.|..
Mouse  1336 GKDILKEEEELVLNEER---------IKSSE-------KIVPKESSCKGDKELLPSLLSQLTGPV 1384

  Fly   544 DDIPEIA------FYMVGDAEEVLAKAT----QLAASMSGDAPPAK-----AEAKKDEKKDTKPE 593
            .::||..      ..|.||..||.....    ||.  .:|..|..:     .|.:|.|    .|.
Mouse  1385 LELPEATRAPLEELMMEGDLLEVTLDENYSIWQLL--QAGQNPNLERIHTLLELEKPE----NPG 1443

  Fly   594 EGKKEEPP--------------KGED--------KKEEAKDDKPKE 617
            ...:|:.|              ||||        |:.::...||||
Mouse  1444 NWSEEQTPERRRQRRQKVVLSRKGEDFTQKELESKRVKSSRIKPKE 1489

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 26/99 (26%)
ATP-synt_ab_N 106..173 CDD:280947
F1-ATPase_beta 175..454 CDD:238553
ATP-synt_ab_C 462..571 CDD:278722 26/102 (25%)
Kdm5dNP_035549.1 JmjN 13..54 CDD:128818
BRIGHT 80..170 CDD:128777
PHD1_KDM5C_5D 325..370 CDD:277077
JmjC 500..616 CDD:202224
zf-C5HC2 706..758 CDD:280996
PLU-1 771..1094 CDD:285609
PHD_SF 1182..1242 CDD:304600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.