powered by:
                  
 
    
 
    
             
          
            Protein Alignment ATPsynbetaL and Kdm5d
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_648836.2 | 
            Gene: | ATPsynbetaL / 39761 | 
            FlyBaseID: | FBgn0036568 | 
            Length: | 622 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_035549.1 | 
            Gene: | Kdm5d / 20592 | 
            MGIID: | 99780 | 
            Length: | 1548 | 
            Species: | Mus musculus | 
          
        
        
        
          
            | Alignment Length: | 176 | 
            Identity: | 43/176 - (24%) | 
          
          
            | Similarity: | 60/176 -  (34%) | 
            Gaps: | 66/176 - (37%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly   486 GMDELSEEDKLTVARARKMQRFLSQPFQVAEIFTGHPGKLVPVEKCVEGFKRL-------LNGEY 543 
            |.|.|.||::|.:...|         .:.:|       |:||.|...:|.|.|       |.|.. 
Mouse  1336 GKDILKEEEELVLNEER---------IKSSE-------KIVPKESSCKGDKELLPSLLSQLTGPV 1384 
 
  Fly   544 DDIPEIA------FYMVGDAEEVLAKAT----QLAASMSGDAPPAK-----AEAKKDEKKDTKPE 593 
            .::||..      ..|.||..||.....    ||.  .:|..|..:     .|.:|.|    .|. 
Mouse  1385 LELPEATRAPLEELMMEGDLLEVTLDENYSIWQLL--QAGQNPNLERIHTLLELEKPE----NPG 1443 
 
  Fly   594 EGKKEEPP--------------KGED--------KKEEAKDDKPKE 617 
            ...:|:.|              ||||        |:.::...|||| 
Mouse  1444 NWSEEQTPERRRQRRQKVVLSRKGEDFTQKELESKRVKSSRIKPKE 1489 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            E1_COG0055 | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            1 | 0.900 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.