DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATPsynbetaL and jmjd-3.3

Sequence 1:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001309680.1 Gene:jmjd-3.3 WormBaseID:WBGene00007813 Length:753 Species:Caenorhabditis elegans

Alignment Length:382 Identity:71/383 (19%)
Similarity:139/383 (36%) Gaps:95/383 (25%)


  Fly   259 LIMELINNIAKSHGGYSVFVGAGERTREG-NDLYHEMIESKVISLEDDSSKV-VLVFGQMNEPPG 321
            ||.::.|.|....|.......:..|.|:. ||   |....|:...||.::.| |.:....:|.|.
 Worm    37 LIAKIENEIVIEKGKTLTLPDSPSRKRKAPND---ESSTFKIPKTEDPANNVEVDMKLASSESPN 98

  Fly   322 ARSRVVLTGLTIAEYFRDVDGQDVLLFIDN--------IFRFTQAGSEVSALLGRIPSA------ 372
            :..           |.......::.|..:|        |..|.::..||...:..:|.:      
 Worm    99 SNF-----------YVAQCMAHNIHLLPENTNKETKLKILEFIKSEDEVDCSMNLVPLSSNRPDY 152

  Fly   373 ---VGYQPTLGTDMGTMQERITSTRNGSITSVQAVYVPADDLSDPAPAATFSHLDATTVLSR--- 431
               .|.:..|...:..::...:....|..:.:|:...|.::.|:            ..::.|   
 Worm   153 MLTSGVRQILKNLVSAVENSKSKNTRGRKSKIQSNLTPINEKSE------------CKIIKRKNE 205

  Fly   432 --PIAELGIYPAVDPLDSSSRILDPDVV---------GEEH-YNVAR-AVQK-TLQAYKSLQDII 482
              |:..|.:...:|||.:|.    .::|         |..: ||..: |.|| |..|.:|  :..
 Worm   206 KTPLLLLTVPMFLDPLTTSG----TEIVKKASEWLTTGRNNVYNDKKFAFQKNTKSAVRS--NFF 264

  Fly   483 AILGMDELSEEDKLTVARARKMQRFLSQP-FQVAEIFTGHPGKLV---PVEKC-VEGFKRLLNGE 542
            ...|.:.|:::.....|:..:::.|..:| |.:..:.|     ||   |:  | :.|..:.:..:
 Worm   265 QKKGFEPLAKQKPKQSAQRAQVEVFQVEPGFDLTNLET-----LVTSSPI--CIIRGLGQAVYMD 322

  Fly   543 YD--DIPEIAFYMVGDAEEVL----------AKATQLAASMSGDAPPAKAEAKKDEK 587
            :.  |:..:|..   |.|:|:          .|..:||.:..|....|:.:...:|:
 Worm   323 FSLFDLQNVAGL---DGEQVIDVRRQRSQHSTKNIKLAHTSKGSLEAAERKWNDEER 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 67/362 (19%)
ATP-synt_ab_N 106..173 CDD:280947
F1-ATPase_beta 175..454 CDD:238553 38/219 (17%)
ATP-synt_ab_C 462..571 CDD:278722 28/128 (22%)
jmjd-3.3NP_001309680.1 JmjC 497..605 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.