DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX1 and toy

DIOPT Version :9

Sequence 1:NP_005559.2 Gene:LHX1 / 3975 HGNCID:6593 Length:406 Species:Homo sapiens
Sequence 2:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster


Alignment Length:296 Identity:79/296 - (26%)
Similarity:122/296 - (41%) Gaps:53/296 - (17%)


- Green bases have known domain annotations that are detailed below.


Human   118 YLSNSSVAKENSLHSATTGSDP-SLSPD-------------SQDPSQDDAKDSESANVSDKEAGS 168
            |.||::.|......:|:..:.| :||..             |.:.|..::.||.|...|:..:..
  Fly   187 YPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSG 251

Human   169 NENDDQNLGAKRR--GPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNR 231
            :|:....|..||:  ..||:...:|:::|:..|..|..|....||:||.:.||....|||||.||
  Fly   252 DEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNR 316

Human   232 RSKERRMKQLSALGARRHAFFRSPRRMRPLVD---RLEPGELIPNGPFSFYGDYQSEYYGPGGNY 293
            |:|.||.:::           |:.||....||   |..... .|:|..:......|....||...
  Fly   317 RAKWRREEKM-----------RTQRRSADTVDGSGRTSTAN-NPSGTTASSSVATSNNSTPGIVN 369

Human   294 DFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPE 358
            ........:|.|.....|| ..|:||  |.|||            ||.     ..|...:||..:
  Fly   370 SAINVAERTSSALVSNSLP-EASNGP--TVLGG------------EAN-----TTHTSSESPPLQ 414

Human   359 PSLPG-PLHSMSAEVFGPSP-PFSSLSVNGGASYGN 392
            |:.|. ||:|....::...| |.::::.|..:|.|:
  Fly   415 PAAPRLPLNSGFNTMYSSIPQPIATMAENYNSSLGS 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX1NP_005559.2 LIM1_Lhx1_Lhx5 4..55 CDD:188753
LIM2_Lhx1_Lhx5 63..118 CDD:188761 79/296 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..187 16/74 (22%)
Homeobox 183..236 CDD:278475 22/52 (42%)
An_peroxidase_like <291..>382 CDD:265428 23/92 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..374 21/81 (26%)
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 39/126 (31%)
Homeobox 269..322 CDD:395001 22/52 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.